Property Summary

NCBI Gene PubMed Count 3
PubMed Score 506.76
PubTator Score 337.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.200 3.1e-05

Gene RIF (1)

AA Sequence

MMWLLLTTTCLICGTLNAGGFLDLENEVNPEVWMNTSEIIIYNGYPSEEYEVTTEDGYILLVNRIPYGRT      1 - 70
HARSTGPRPVVYMQHALFADNAYWLENYANGSLGFLLADAGYDVWMGNSRGNTWSRRHKTLSETDEKFWA     71 - 140
FSFDEMAKYDLPGVIDFIVNKTGQEKLYFIGHSLGTTIGFVAFSTMPELAQRIKMNFALGPTISFKYPTG    141 - 210
IFTRFFLLPNSIIKAVFGTKGFFLEDKKTKIASTKICNNKILWLICSEFMSLWAGSNKKNMNQSRMDVYM    211 - 280
SHAPTGSSVHNILHIKQLYHSDEFRAYDWGNDADNMKHYNQSHPPIYDLTAMKVPTAIWAGGHDVLVTPQ    281 - 350
DVARILPQIKSLHYFKLLPDWNHFDFVWGLDAPQRMYSEIIALMKAYS                          351 - 398
//

Text Mined References (3)

PMID Year Title