Property Summary

NCBI Gene PubMed Count 8
Grant Count 3
Funding $372,319
PubMed Score 6.09
PubTator Score 4.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma -1.700 0.018
psoriasis 1.600 0.001
group 4 medulloblastoma -1.500 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
non-small cell lung cancer 2.128 0.000
lung cancer -1.200 0.001
interstitial cystitis -1.800 0.000
cystic fibrosis -1.100 0.036
posterior fossa group A ependymoma 1.100 0.001
lung carcinoma 3.000 0.000
Pick disease -1.200 0.001
gastric carcinoma -1.500 0.008
ovarian cancer 1.700 0.000
pituitary cancer -2.400 0.000

Gene RIF (4)

PMID Text
26480818 SUSD4 expression in both breast cancer cells and T cells infiltrating the tumor-associated stroma is useful to predict better prognosis of breast cancer patients.
23482636 Membrane-bound isoform SUSD4a inhibits the classical and alternative complement pathways when expressed on the surface of Chinese hamster cells but not when expressed as a soluble, truncated protein.
20348246 analysis of cloning, expression, refolding, and tissue distribution of Sushi domain-containing protein 4
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTP      1 - 70
SGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHG     71 - 140
EKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRC    141 - 210
FPGFKLDGSAYLECLQNLIWSSSPPRCLALEVCPLPPMVSHGDFVCHPRPCERYNHGTVVEFYCDPGYSL    211 - 280
TSDYKYITCQYGEWFPSYQVYCIKSEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAH    281 - 350
FPPRGPPRSSSSDPDFVVVDGVPVMLPSYDEAVSGGLSALGPGYMASVGQGCPLPVDDQSPPAYPGSGDT    351 - 420
DTGPGESETCDSVSGSSELLQSLYSPPRCQESTHPASDNPDIIASTAEEVASTSPGIDIADEIPLMEEDP    421 - 490
//

Text Mined References (10)

PMID Year Title
26480818 2015 The human complement inhibitor Sushi Domain-Containing Protein 4 (SUSD4) expression in tumor cells and infiltrating T cells is associated with better prognosis of breast cancer patients.
23482636 2013 Sushi domain-containing protein 4 (SUSD4) inhibits complement by disrupting the formation of the classical C3 convertase.
20348246 2010 Tissue distribution and functional analysis of Sushi domain-containing protein 4.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.