Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.09
PubTator Score 4.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
lung carcinoma 2844 8.19458111729722E-36
non-small cell lung cancer 2798 8.01584261383312E-12
atypical teratoid/rhabdoid tumor 1095 3.03059097338689E-6
group 4 medulloblastoma 1875 4.03519821891455E-5
interstitial cystitis 2299 1.95976643925156E-4
ovarian cancer 8492 2.90958302939636E-4
pituitary cancer 1972 4.45175256151657E-4
posterior fossa group A ependymoma 1511 5.49152007495137E-4
lung cancer 4473 8.25688342312012E-4
Pick disease 1893 0.00117535896617623
psoriasis 6685 0.00125294347098254
gastric carcinoma 832 0.00754866997656261
esophageal adenocarcinoma 737 0.0179350527878244
cystic fibrosis 1670 0.0355432956475918

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma -1.700 0.018
psoriasis 1.600 0.001
group 4 medulloblastoma -1.500 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
non-small cell lung cancer 2.128 0.000
lung cancer -1.200 0.001
interstitial cystitis -1.800 0.000
cystic fibrosis -1.100 0.036
posterior fossa group A ependymoma 1.100 0.001
lung carcinoma 3.000 0.000
Pick disease -1.200 0.001
gastric carcinoma -1.500 0.008
ovarian cancer 1.700 0.000
pituitary cancer -2.400 0.000

Synonym

Accession Q5VX71 D3DTB9 Q6UX62 Q9BSR0 Q9NWG0
Symbols PRO222

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (4)

PMID Text
26480818 SUSD4 expression in both breast cancer cells and T cells infiltrating the tumor-associated stroma is useful to predict better prognosis of breast cancer patients.
23482636 Membrane-bound isoform SUSD4a inhibits the classical and alternative complement pathways when expressed on the surface of Chinese hamster cells but not when expressed as a soluble, truncated protein.
20348246 analysis of cloning, expression, refolding, and tissue distribution of Sushi domain-containing protein 4
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTP      1 - 70
SGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHG     71 - 140
EKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRC    141 - 210
FPGFKLDGSAYLECLQNLIWSSSPPRCLALEVCPLPPMVSHGDFVCHPRPCERYNHGTVVEFYCDPGYSL    211 - 280
TSDYKYITCQYGEWFPSYQVYCIKSEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAH    281 - 350
FPPRGPPRSSSSDPDFVVVDGVPVMLPSYDEAVSGGLSALGPGYMASVGQGCPLPVDDQSPPAYPGSGDT    351 - 420
DTGPGESETCDSVSGSSELLQSLYSPPRCQESTHPASDNPDIIASTAEEVASTSPGIDIADEIPLMEEDP    421 - 490
//

Text Mined References (10)

PMID Year Title
26480818 2015 The human complement inhibitor Sushi Domain-Containing Protein 4 (SUSD4) expression in tumor cells and infiltrating T cells is associated with better prognosis of breast cancer patients.
23482636 2013 Sushi domain-containing protein 4 (SUSD4) inhibits complement by disrupting the formation of the classical C3 convertase.
20348246 2010 Tissue distribution and functional analysis of Sushi domain-containing protein 4.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.