Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.82
PubTator Score 4.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.600 9.1e-05
cystic fibrosis -1.100 3.6e-02
esophageal adenocarcinoma -1.700 1.8e-02
gastric carcinoma -1.100 2.5e-02
group 4 medulloblastoma -1.500 4.0e-05
interstitial cystitis -1.300 6.7e-03
lung cancer -1.200 8.3e-04
lung carcinoma 3.000 8.2e-36
non-small cell lung cancer 1.759 2.3e-12
ovarian cancer 1.600 9.2e-08
Pick disease -1.200 1.2e-03
pituitary cancer -2.400 4.5e-04
posterior fossa group A ependymoma 1.100 5.5e-04
psoriasis 1.600 1.3e-03

Gene RIF (4)

AA Sequence

MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTP      1 - 70
SGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHG     71 - 140
EKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRC    141 - 210
FPGFKLDGSAYLECLQNLIWSSSPPRCLALEVCPLPPMVSHGDFVCHPRPCERYNHGTVVEFYCDPGYSL    211 - 280
TSDYKYITCQYGEWFPSYQVYCIKSEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAH    281 - 350
FPPRGPPRSSSSDPDFVVVDGVPVMLPSYDEAVSGGLSALGPGYMASVGQGCPLPVDDQSPPAYPGSGDT    351 - 420
DTGPGESETCDSVSGSSELLQSLYSPPRCQESTHPASDNPDIIASTAEEVASTSPGIDIADEIPLMEEDP    421 - 490
//

Text Mined References (10)

PMID Year Title