Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.06
PubTator Score 12.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession Q5VWZ2 A8K677 Q5VWZ3 Q7Z4A3 Q96AV0
Symbols Q96AV0

Gene

PANTHER Protein Class (3)

PDB

3U0V   5KRE  

Gene RIF (10)

PMID Text
23221025 Our results suggest that LYPLAL1 rs4846567 and NISCH rs6784615 may influence fat distribution in the Japanese population.
22179955 Gene-treatment interactions were observed for short-term weight loss. (LYPLAL1 rs2605100, Plifestyle*SNP = 0.032)
22052940 LYPLAL1 exhibits neither phospholipase nor triacylglycerol lipase activity, but rather accepts short-chain substrates
21953277 genetic association studies in Danish population: Quantitative metabolic phenotypes in obesity are associated with SNP in various genes: LYPLAL1 (rs4846567) is associated with waist-hip ratio and insulin sensitivity in women.
21674055 central obesity-associated variants in LYPLAL1, NRXN3, MSRA, and TFAP2B
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20703240 Observational study of gene-disease association. (HuGE Navigator)
19557161 TFAP2B, LYPLAL1 and MSRA are associated with adiposity and fat distribution.
19557161 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMK      1 - 70
GGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAIHLAYRNHQD     71 - 140
VAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVY    141 - 210
HELSKTELDILKLWILTKLPGEMEKQK                                               211 - 237
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23754948 2013 Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23221025 2013 Replication study of 15 recently published Loci for body fat distribution in the Japanese population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
More...