Property Summary

NCBI Gene PubMed Count 26
PubMed Score 14.35
PubTator Score 12.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia -1.300 1.4e-02
gastric cancer 1.500 8.8e-03
hepatocellular carcinoma 1.200 2.6e-04
juvenile dermatomyositis 1.051 4.1e-08
medulloblastoma, large-cell -1.200 1.8e-04
non-small cell lung cancer -1.040 1.3e-10
ovarian cancer -3.000 3.1e-05
pancreatic cancer 1.700 2.6e-03
pancreatic carcinoma 1.700 2.6e-03
progressive supranuclear palsy -1.200 2.4e-02
subependymal giant cell astrocytoma 1.913 2.9e-02

Gene RIF (14)

AA Sequence

MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMK      1 - 70
GGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAIHLAYRNHQD     71 - 140
VAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVY    141 - 210
HELSKTELDILKLWILTKLPGEMEKQK                                               211 - 237
//

Text Mined References (33)

PMID Year Title