Property Summary

NCBI Gene PubMed Count 65
Grant Count 12
R01 Count 8
Funding $994,318.98
PubMed Score 53.63
PubTator Score 51.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.200 0.000
non-inflammatory breast cancer -1.100 0.007

Gene RIF (46)

PMID Text
26587829 Infiltrating T cells regulate ERbeta/DAB2IP signals in renal cell carcinoma.
26564738 Data show that colorectal cancer (CRC) patients with lower DAB2 interaction protein (DAB2IP) expression had shorter overall survival time.
26471467 Pretreatment biopsy analysis of DAB2IP identifies subpopulation of high-risk prostate cancer patients with worse survival following radiation therapy
26410305 DAB2IP could inhibit the phosphorylation and transactivation of STAT3, and then subsequently suppress the expression of Twist1 and its target gene P-glycoprotein, both of which were crucial for the pirarubicin chemoresistance.
26336990 Snail and DAB2IP interact to regulate EMT, invasion and metastasis in colorectal cancer
26021979 High glucose increases AIP1 expression and decreases the expression of HIF-1alpha and downstream molecules. Decreased HIF-1alpha signaling may be regulated by increased AIP1 under high glucose.
25841337 miR-889 is an important regulator in ESCC and both miR-889 and DAB2IP may serve as promising biomarkers and therapeutic targets in patients with ESCC.
25604087 strongly expressed in villi and extravillous trophoblasts but not in pre-eclampsia placentas
25454946 Study showed that DAB2IP can be functionally inactivated by physical interaction with mutant p53 proteins with implications for the response of cancer cells to inflammatory cytokines.
25115390 Immunohistochemical study exhibited an inverse correlation between DAB2IP and Skp2 protein expression in the prostate cancer tissue microarray.
More...

AA Sequence

MSAGGSARKSTGRSSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSLSEKSPSMEPSAA      1 - 70
TPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHESLLSP     71 - 140
SSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKWMENLRRAVHPNKDNSRR    141 - 210
VEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETD    211 - 280
KKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAE    281 - 350
HITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATK    351 - 420
AIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSAADLPEHQGNLKMCCELAFCKIINSYCVFP    421 - 490
RELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQN    491 - 560
LANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVSQ    561 - 630
LEQSIVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRL    631 - 700
PSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDVL    701 - 770
PTDGQAAAAQLVAGWPARATPVNLAGLATVRRAGQTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLP    771 - 840
LSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKGGQPTVPRQNS    841 - 910
AGPQRRIDQPPPPPPPPPPAPRGRTPPNLLSTLQYPRPSSGTLASASPDWVGPSTRLRQQSSSSKGDSPE    911 - 980
LKPRAVHKQGPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKDELSQAEKDLAVLQDKLR    981 - 1050
ISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEM   1051 - 1120
QAAVDSKQKIIDAQEKRIASLDAANARLMSALTQLKERYSMQARNGISPTNPTKLQITENGEFRNSSNC    1121 - 1189
//

Text Mined References (72)

PMID Year Title
26587829 2015 Infiltrating T cells promote renal cell carcinoma (RCC) progression via altering the estrogen receptor ?-DAB2IP signals.
26564738 2015 Absence of DAB2IP promotes cancer stem cell like signatures and indicates poor survival outcome in colorectal cancer.
26471467 2015 Pretreatment biopsy analysis of DAB2IP identifies subpopulation of high-risk prostate cancer patients with worse survival following radiation therapy.
26410305 2015 DAB2IP regulates the chemoresistance to pirarubicin and tumor recurrence of non-muscle invasive bladder cancer through STAT3/Twist1/P-glycoprotein signaling.
26336990 2015 The positive feedback between Snail and DAB2IP regulates EMT, invasion and metastasis in colorectal cancer.
26021979 2015 High glucose and/or high insulin affects HIF-1 signaling by regulating AIP1 in human umbilical vein endothelial cells.
25841337 2015 miR-889 promotes proliferation of esophageal squamous cell carcinomas through DAB2IP.
25604087 2016 Expression of DAB2IP in human trophoblast and its role in trophoblast invasion.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25454946 2014 Mutant p53 reprograms TNF signaling in cancer cells through interaction with the tumor suppressor DAB2IP.
More...