Property Summary

NCBI Gene PubMed Count 15
PubMed Score 28.41
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.006 5.7e-03
astrocytic glioma -1.500 2.0e-02
atypical teratoid / rhabdoid tumor -2.900 3.4e-04
glioblastoma -1.200 3.1e-02
group 4 medulloblastoma -2.500 1.4e-03
lung carcinoma 4.000 9.8e-17
medulloblastoma, large-cell -3.300 1.0e-05
oligodendroglioma -1.100 1.0e-08
Pick disease -1.500 2.5e-03
posterior fossa group A ependymoma 2.000 2.2e-05
primitive neuroectodermal tumor -3.800 3.6e-06
subependymal giant cell astrocytoma 3.429 9.4e-03

Gene RIF (3)

AA Sequence

MELEKREKRSLLNKNLEEKLTVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEESSDKSPET      1 - 70
VNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDE     71 - 140
AASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQQYKTKS    141 - 210
SYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHS    211 - 280
SDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEEE    281 - 350
VYEPNPFSKYLEDNSDLFSEQDVTVPPKPVSLHPLYQTKLYPPAKSLLHPQTLSHADCLAPGPFSHLSFS    351 - 420
LSDEQENSHTLLSHNACNKLSHPMVAIPEHEALDSKEQ                                    421 - 458
//

Text Mined References (15)

PMID Year Title