Property Summary

NCBI Gene PubMed Count 15
PubMed Score 26.80
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 9.82305490397504E-17
medulloblastoma 1524 1.74143778253914E-10
oligodendroglioma 2849 1.03799065741611E-8
posterior fossa group B ependymoma 1530 6.79770019140461E-8
primitive neuroectodermal tumor 3031 3.63831152994319E-6
medulloblastoma, large-cell 6234 1.04087976238318E-5
atypical teratoid / rhabdoid tumor 4369 3.43248758968011E-4
glioblastoma 5572 0.0020879081614488
Pick disease 1893 0.00251625220500499
aldosterone-producing adenoma 664 0.0056727998826322
subependymal giant cell astrocytoma 2287 0.00938229059278127
astrocytic glioma 2241 0.0201798797393863

Expression

  Differential Expression (12)

Synonym

Accession Q5VWP3 B7Z2N0 D6RE05 Q96H08 Q96NF7
Symbols CIP
C6orf142

Gene

  Ortholog (9)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG

Gene RIF (3)

PMID Text
26436652 CIP expression is reduced in patients with dilated cardiomyopathy.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of muscular LMNA-interacting protein (MLIP; C6orf142) in primary human brain microvascular endothelial cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MELEKREKRSLLNKNLEEKLTVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEESSDKSPET      1 - 70
VNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDE     71 - 140
AASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQQYKTKS    141 - 210
SYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHS    211 - 280
SDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEEE    281 - 350
VYEPNPFSKYLEDNSDLFSEQDVTVPPKPVSLHPLYQTKLYPPAKSLLHPQTLSHADCLAPGPFSHLSFS    351 - 420
LSDEQENSHTLLSHNACNKLSHPMVAIPEHEALDSKEQ                                    421 - 458
//

Text Mined References (15)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26436652 2015 Cardiomyocyte-enriched protein CIP protects against pathophysiological stresses and regulates cardiac homeostasis.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21498514 2011 Identification of a novel muscle A-type lamin-interacting protein (MLIP).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...