Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.37
PubTator Score 3.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.152 2.3e-02
Breast cancer -1.300 4.0e-02
chronic lymphosyte leukemia -1.200 1.3e-06
chronic rhinosinusitis -1.645 2.8e-02
colon cancer -2.600 2.1e-02
interstitial cystitis 1.700 4.8e-03
intraductal papillary-mucinous neoplasm ... -1.800 4.9e-03
lung cancer -1.100 4.8e-04
mucosa-associated lymphoid tissue lympho... 1.786 2.2e-02
osteosarcoma -3.748 2.9e-04
ovarian cancer -2.100 7.7e-06
pancreatic cancer -1.500 1.8e-04
periodontitis 1.800 1.1e-29
primary pancreatic ductal adenocarcinoma -1.527 3.7e-03
spina bifida -1.665 4.0e-02
tuberculosis -1.200 1.1e-03
ulcerative colitis 1.400 2.4e-03

 Compartment GO Term (1)

Gene RIF (3)

AA Sequence

MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVHDVR      1 - 70
LNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQ     71 - 140
KLVKVCTDTDRWSLISLSNKNGKNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTV    141 - 210
IGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPD    211 - 280
ILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA    281 - 350
TNVTCYYQPAPYVSDGNFSNYYVAHPPVTYSQPYPTWLPCN                                 351 - 391
//

Text Mined References (11)

PMID Year Title