Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.89
PubTator Score 3.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
osteosarcoma -4.165 0.001
chronic lymphosyte leukemia -1.200 0.000
periodontitis 2.300 0.000
primary pancreatic ductal adenocarcinoma -1.527 0.004
tuberculosis -1.200 0.001
intraductal papillary-mucinous neoplasm ... -1.800 0.005
colon cancer -2.600 0.021
lung cancer -1.100 0.000
active Crohn's disease 1.152 0.023
pancreatic cancer -1.500 0.000
interstitial cystitis 3.000 0.000
spina bifida -1.665 0.040
mucosa-associated lymphoid tissue lympho... 1.786 0.022
ulcerative colitis 1.800 0.001
ovarian cancer -2.100 0.000
Breast cancer -1.300 0.040
chronic rhinosinusitis -1.645 0.028

Gene RIF (1)

PMID Text
21994415 Data indicate that when cases with FAM46C deletion or mutation were considered together, they were strongly associated with impaired overall survival (OS) in the intensive treatment setting.

AA Sequence

MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVHDVR      1 - 70
LNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQ     71 - 140
KLVKVCTDTDRWSLISLSNKNGKNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTV    141 - 210
IGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPD    211 - 280
ILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA    281 - 350
TNVTCYYQPAPYVSDGNFSNYYVAHPPVTYSQPYPTWLPCN                                 351 - 391
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21994415 2011 Mapping of chromosome 1p deletions in myeloma identifies FAM46C at 1p12 and CDKN2C at 1p32.3 as being genes in regions associated with adverse survival.
21478870 2011 A diverse range of gene products are effectors of the type I interferon antiviral response.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.