Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.09
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Liposarcoma 20 3.527 1.8

AA Sequence

MSIQAPPRLLELAGQSLLRDQALSISAMEELPRVLYLPLFMEAFRRRHFQTLTVMVQAWPFTCLPLGSLM      1 - 70
KTLHLETLKALLEGLHMLLTQKDRPRRRKLQVLDLRDVDENFWARWPGAWALSCFPETMSKRQTAEDRPR     71 - 140
MGEHQPLKVFIDICLKEIPQDECLRYLFQWVYQRRGLVHLCCSKLVNYLTPIKHLRKSLKIIYLNSIQEL    141 - 210
EIHNMSWPRLIRKLRCYLKEMKTLGKLVFSRCHHSTSDNELEGRLVTKFSSVFLGLEHLQLLKIKLITFF    211 - 280
SGHLEQLIRCLQNPLENLELTYGYLLEEDVKCLSQYPSLGYLKHLNLSYVLLFRISLEPLGALLEKIAAS    281 - 350
LETLILEGCQIHYSQLSAILPGLSRCSQLTTFYFGRNCMSMGALKDLLRHTSGLSKLSLETYPAPEESLN    351 - 420
SLVRVNWEIFTPLRAELMCTLREVRQPKRIFIGPTPCPSCGSSLSEELELHLCC                    421 - 474
//

Text Mined References (1)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.