Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
facioscapulohumeral dystrophy 286

AA Sequence

MSFQAPRRLLELAGQSLLRDQALAISVLDELPRELFPPLFVEAFTSRRCEVLKVMVQAWPFPCLPLGSLM      1 - 70
KTPDLEILHYVVDGIDCLLAQKVRPRRWKLQVLEMRDVDENFWTIWSGARLLSCSPEAMSKRQTVEDCPR     71 - 140
TGEKQPLKVFMDVCLKEKFMDEDLSFFSGWVQHRRGSVHLCCTKVVNYSMSILNFRNILETVYPDSIQVL    141 - 210
EIWNMCWLCMIVEFSRYLSQMRNLRKLFISDGCRYLLSSDSQEQLVAEFSSVLLRLENLQMLYVRRVCFF    211 - 280
RGHLDQLIRCLRSPLETLALTYGFLEEEDLKCLPRYPSLSQLKQLNLSHGALRFIRLEPLRALLEKVAAT    281 - 350
LQTLFLVDCGIGYSKLRVILPALSRCSNLTTFCFHGNDTSMDALKDLLRHTGRLSNLSLETYPAPRESLD    351 - 420
NRGRVILELLTPLQAELMRILREVREPKRIFFGPVSCPCCGTSPTEQLESNFCLWGRPA               421 - 479
//

Text Mined References (3)

PMID Year Title
21347312 2011 The expansion of the PRAME gene family in Eutheria.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16159394 2005 Duplication and positive selection among hominin-specific PRAME genes.