Property Summary

NCBI Gene PubMed Count 302
Grant Count 108
R01 Count 40
Funding $19,523,481.02
PubMed Score 104.81
PubTator Score 358.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.800 0.000
ovarian cancer -1.200 0.000

Gene

Gene RIF (346)

PMID Text
26887945 results suggest a convergent cause of IL23Ralpha variant protection against chronic inflammatory disease.
26829744 Copy number variation of exon 11 in IL-23R is associated with pulmonary tuberculosis in the Chinese Uygur population.
26717375 review and meta-analysis of association of polymorphisms rs6682925, rs10889677 and rs1884444 with cancer risk
26678098 A significant association was found between all Crohn's disease and the rs7517847 polymorphism, especially in Caucasians.
26626589 IL23 receptor single nucleotide polymorphisms and gene copy number variation are associated with susceptibility to pulmonary tuberculosis in Chinese Uygurs.
26547706 R381Q polymorphism in IL-23 receptor may be a predisposing allele for asthma.
26472011 genetic polymorphism is associated with psoriasis in the South Indian Tamils
26375822 Low-Frequency IL23R Coding Variant is Associated with Crohn's Disease Susceptibility.
26269135 it is concluded that the frequency of single nucleotide polymorphism in the IL-23 receptor (R381Q) in patients with recurrent spontaneous abortion (RSA) is less than that found in normal control women.
26263469 Lower LCN2 levels in Crohn's Disease patients carrying IBD risk-increasing IL23R variants may result from a restricted upregulation of LCN2 due to an impaired Th17 immune response
More...

AA Sequence

MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNG      1 - 70
IKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSG     71 - 140
NMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQL    141 - 210
QIHLDDIVIPSAAVISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQS    211 - 280
EFYLEPNIKYVFQVRCQETGKRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDN    281 - 350
RGDIGLLLGMIVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMN    351 - 420
NNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYPQNSLFDNTTVVYIPDLNTGYKPQISN    421 - 490
FLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQKHPNFAFSVSSVNSLSNTIFLGELSLILNQGECSS    491 - 560
PDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGIVNEELPSINTYFPQNILESHFNRISLLEK     561 - 629
//

Text Mined References (303)

PMID Year Title
26887945 2016 IL23R (Interleukin 23 Receptor) Variants Protective against Inflammatory Bowel Diseases (IBD) Display Loss of Function due to Impaired Protein Stability and Intracellular Trafficking.
26829744 2016 [Association of copy number variation of exon 11 of IL-23 receptor gene with susceptibility to tuberculosis among Chinese Uygurs].
26717375 2015 Association of IL-23R Polymorphisms (rs6682925, rs10889677, rs1884444) With Cancer Risk: A PRISMA-Compliant Meta-Analysis.
26678098 2015 Association of Interleukin-23 receptor gene polymorphisms with susceptibility to Crohn's disease: A meta-analysis.
26626589 2015 The variations of IL-23R are associated with susceptibility and severe clinical forms of pulmonary tuberculosis in Chinese Uygurs.
26547706 2015 Association between Interleukin-23 Receptor R381Q Gene.
26472011 2016 Investigation of association of the IL-12B and IL-23R genetic variations with psoriatic risk in a South Indian Tamil cohort.
26375822 2015 Low-Frequency IL23R Coding Variant Associated with Crohn's Disease Susceptibility in Japanese Subjects Identified by Personal Genomics Analysis.
26269135 2015 Association between lower frequency of R381Q variant (rs11209026) in IL-23 receptor gene and increased risk of recurrent spontaneous abortion (RSA).
26263469 2015 Lipocalin-2 Is a Disease Activity Marker in Inflammatory Bowel Disease Regulated by IL-17A, IL-22, and TNF-? and Modulated by IL23R Genotype Status.
More...