Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.500 0.035
ependymoma -1.900 0.047
atypical teratoid / rhabdoid tumor -1.500 0.000
tuberculosis and treatment for 6 months 1.100 0.000
non-small cell lung cancer -1.541 0.000
subependymal giant cell astrocytoma -1.996 0.011
lung carcinoma -1.500 0.000
ulcerative colitis -1.700 0.000
ovarian cancer -1.600 0.000

Gene RIF (1)

PMID Text
20583170 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGGPPKALPSTGPHSLRDMPHPLAGSSSEEAVGGDSTPSPDLLMARSFGDKDLILPNGGTPAGTSSPAS      1 - 70
SSSLLNRLQLDDDIDGETRDLFVIVDDPKKHVCTMETYITYRITTKSTRVEFDLPEYSVRRRYQDFDWLR     71 - 140
SKLEESQPTHLIPPLPEKFVVKGVVDRFSEEFVETRRKALDKFLKRITDHPVLSFNEHFNIFLTAKDLNA    141 - 210
YKKQGIALLTRMGESVKHVTGGYKLRTRPLEFAAIGDYLDTFALKLGTIDRIAQRIIKEEIEYLVELREY    211 - 280
GPVYSTWSALEGELAEPLEGVSACIGNCSTALEELTDDMTEDFLPVLREYILYSDSMKSVLKKRDQVQAE    281 - 350
YEAKLEAVALRKEDRPKVPADVEKCQDRMECFNADLKADMERWQNNKRQDFRQLLMGMADKNIQYYEKCL    351 - 420
MAWESIIPLLQEKQEAK                                                         421 - 437
//

Text Mined References (9)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
21269460 2011 Initial characterization of the human central proteome.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.