Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.70
PubTator Score 3.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Colorectal Neoplasms 217
Disease Target Count P-value
posterior fossa group A ependymoma 1511 2.03629622230567E-12
pilocytic astrocytoma 3086 4.82324334835267E-11
glioblastoma 5572 5.72725530004957E-10
adult high grade glioma 2148 8.76283352990657E-7
group 3 medulloblastoma 2254 4.90179294401944E-5
astrocytic glioma 2241 0.0014416809655487
oligodendroglioma 2849 0.00321653203275262
atypical teratoid / rhabdoid tumor 4369 0.0109330603285973
pituitary cancer 1972 0.0399178663475027

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.800 0.001
oligodendroglioma -2.000 0.003
glioblastoma -2.500 0.000
posterior fossa group A ependymoma -2.600 0.000
atypical teratoid / rhabdoid tumor -1.500 0.011
adult high grade glioma -2.600 0.000
group 3 medulloblastoma -2.800 0.000
pilocytic astrocytoma -2.900 0.000
pituitary cancer 1.100 0.040

Gene RIF (4)

PMID Text
22791750 TCERG1L is associated with plasma adiponectin, a key modulator of obesity, inflammation, IR and diabetes.
20732627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQAGARFQRRRRQLQQQQPRRRQPLLWPMDAEPPPPPPWVWMVPGSAGLLRLSAGVVVPPVLLASAPPPA      1 - 70
APLLPGLPGWPAPSEPVLPLLPLPSAPDSAAAAAAHPFPALHGQWLFGGHSPSLGLPPSSTVELVPVFPH     71 - 140
LCPSALATPIGKSWIDKRIPNCKIFFNNSFALDSTWIHPEESRFFHGHEKPRLLANQVAVSLSRPAPASR    141 - 210
PLPTVVLAPQPIPGGCHNSLKVTSSPAIAIATAAAAAMVSVDPENLRGPSPSSVQPRHFLTLAPIKIPLR    211 - 280
TSPVSDTRTERGRVARPPALMLRAQKSRDGDKEDKEPPPMLGGGEDSTARGNRPVASTPVPGSPWCVVWT    281 - 350
GDDRVFFFNPTMHLSVWEKPMDLKDRGDLNRIIEDPPHKRKLEAPATDNSDGSSSEDNREDQDVKTKRNR    351 - 420
TEGCGSPKPEEAKREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIVFDPRYLLLNS    421 - 490
EERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQ    491 - 560
EHFFNQFILILKKRDKENRLRLRKMR                                                561 - 586
//

Text Mined References (13)

PMID Year Title
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22791750 2012 Genome-wide association study identifies novel loci association with fasting insulin and insulin resistance in African Americans.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
20732627 2010 Case-control genome-wide association study of attention-deficit/hyperactivity disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...