Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.92
PubTator Score 3.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -2.600 8.8e-07
astrocytic glioma -1.800 1.4e-03
Astrocytoma, Pilocytic -2.900 4.4e-11
atypical teratoid / rhabdoid tumor -1.500 1.1e-02
ependymoma -1.700 3.7e-04
glioblastoma -2.500 5.7e-10
group 3 medulloblastoma -2.800 4.9e-05
oligodendroglioma -2.000 3.2e-03
pituitary cancer 1.100 4.0e-02

Gene RIF (4)

AA Sequence

MQAGARFQRRRRQLQQQQPRRRQPLLWPMDAEPPPPPPWVWMVPGSAGLLRLSAGVVVPPVLLASAPPPA      1 - 70
APLLPGLPGWPAPSEPVLPLLPLPSAPDSAAAAAAHPFPALHGQWLFGGHSPSLGLPPSSTVELVPVFPH     71 - 140
LCPSALATPIGKSWIDKRIPNCKIFFNNSFALDSTWIHPEESRFFHGHEKPRLLANQVAVSLSRPAPASR    141 - 210
PLPTVVLAPQPIPGGCHNSLKVTSSPAIAIATAAAAAMVSVDPENLRGPSPSSVQPRHFLTLAPIKIPLR    211 - 280
TSPVSDTRTERGRVARPPALMLRAQKSRDGDKEDKEPPPMLGGGEDSTARGNRPVASTPVPGSPWCVVWT    281 - 350
GDDRVFFFNPTMHLSVWEKPMDLKDRGDLNRIIEDPPHKRKLEAPATDNSDGSSSEDNREDQDVKTKRNR    351 - 420
TEGCGSPKPEEAKREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIVFDPRYLLLNS    421 - 490
EERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQ    491 - 560
EHFFNQFILILKKRDKENRLRLRKMR                                                561 - 586
//

Text Mined References (13)

PMID Year Title