Property Summary

NCBI Gene PubMed Count 18
Grant Count 6
Funding $1,377,590.8
PubMed Score 8.61
PubTator Score 13.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.976 0.000
adult high grade glioma -1.200 0.000
sonic hedgehog group medulloblastoma -1.200 0.000

 GO Function (1)

 GWAS Trait (1)

Gene RIF (17)

PMID Text
23935956 Data show that transcription cofactor TAF3 is required for transcription of the alpha spectrin SPTA1 gene.
23452851 Study shows that H3K4me3-TAF3 interactions direct global TFIID recruitment to active genes, some of which are p53 targets. Further analyses show that H3K4me3 enhances p53-dependent transcription by stimulating preinitiation complex formation.
21884934 Study shows that this TAF3 activity is critical for early lineage segregation during stem cell differentiation.
20808825 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18549481 Data identified TAF3 as an evolutionarily conserved negative regulator of p53 transcription activation function.
17975119 Observational study of gene-disease association. (HuGE Navigator)
9054383 A novel function of LBP-1, restricting HIV-1 transcription at the level of elongation by preventing the binding of TFIID to the promoter, is suppressed by HIV-1 Tat, indicating Tat helps recruit TFIID to the HIV-1 LTR
8849451 A novel function of LBP-1, restricting HIV-1 transcription at the level of elongation by preventing the binding of TFIID to the promoter, is suppressed by HIV-1 Tat, indicating Tat helps recruit TFIID to the HIV-1 LTR
More...

AA Sequence

MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTDPILDDVGEAF      1 - 70
QLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEE     71 - 140
EQVPTDGGTSAEAMQVPLEEDDELEEEEIINDENFLGKRPLDSPEAEELPAMKRPRLLSTKGDTLDVVLL    141 - 210
EAREPLSSINTQKIPPMLSPVHVQDSTDLAPPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPG    211 - 280
QKTKSPKTAQSPAMVGSPIRSPKTVSKEKKSPGRSKSPKSPKSPKVTTHIPQTPVRPETPNRTPSATLSE    281 - 350
KISKETIQVKQIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACAEREPDPFEFSSGSESEGDIF    351 - 420
TSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLGTPSNMPPNFP    421 - 490
YISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQRDREREKDKNKDKSKEKDKVK    491 - 560
EKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDPKVKLKDGLVRKEKEKHKDKKKDREKGKKDK    561 - 630
DKREKEKVKDKGREDKMKAPAPPLVLPPKELALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKE    631 - 700
KKKDKKEKKKKKEKEKEKKEKEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQD    701 - 770
KIVISKVVPAPEAKPAPSQNRPKTPPPAPAPAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASA    771 - 840
KAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCP    841 - 910
KCANKKKDKKHKKRKHRAH                                                       911 - 929
//

Text Mined References (26)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23935956 2013 Genome wide association analysis of a founder population identified TAF3 as a gene for MCHC in humans.
23452851 2013 H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21884934 2011 Control of embryonic stem cell lineage commitment by core promoter factor, TAF3.
20953165 2010 A phospho/methyl switch at histone H3 regulates TFIID association with mitotic chromosomes.
20808825 2010 Novel association strategy with copy number variation for identifying new risk Loci of human diseases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...