Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.12
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -2.185 4.3e-04
Astrocytoma, Pilocytic 1.300 1.9e-05
cystic fibrosis 1.625 1.7e-04
ependymoma -1.400 2.1e-02
group 3 medulloblastoma -1.600 1.2e-03
intraductal papillary-mucinous adenoma (... -1.500 5.0e-02
intraductal papillary-mucinous carcinoma... -2.300 6.6e-03
lung adenocarcinoma -1.100 8.6e-08
lung carcinoma -3.300 7.5e-44
non-small cell lung cancer -1.808 2.4e-22
oligodendroglioma -1.900 8.0e-03
osteosarcoma -1.222 2.9e-02
ovarian cancer -2.100 3.2e-05
Pick disease 1.200 1.4e-02
pituitary cancer 2.500 2.2e-08
primary Sjogren syndrome 1.100 1.9e-02
subependymal giant cell astrocytoma 2.713 4.2e-03
tuberculosis 1.600 4.9e-09
ulcerative colitis 1.400 5.5e-04

Gene RIF (2)

AA Sequence

MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLVMRLCQSVSLL      1 - 70
ELLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFWNLLDMVRYTYSMLSVIGIS     71 - 140
YAVLTWLSQTLWMPIYPLCVLAEAFAIYQSLPYFESFGTYSTKLPFDLSIYFPYVLKIYLMMLFIGMYFT    141 - 210
YSHLYSERRDILGIFPIKKKKM                                                    211 - 232
//

Text Mined References (9)

PMID Year Title