Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.17
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q5VWC8 Q7Z385
Symbols PTPLAD2

Gene

Gene RIF (1)

PMID Text
24530685 PTPLAD2 is a potential tumor suppressor and prognostic indicator that reduces STAT3 phosphorylation.

AA Sequence

MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLVMRLCQSVSLL      1 - 70
ELLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFWNLLDMVRYTYSMLSVIGIS     71 - 140
YAVLTWLSQTLWMPIYPLCVLAEAFAIYQSLPYFESFGTYSTKLPFDLSIYFPYVLKIYLMMLFIGMYFT    141 - 210
YSHLYSERRDILGIFPIKKKKM                                                    211 - 232
//

Text Mined References (8)

PMID Year Title
24530685 2014 PTPLAD2 is a tumor suppressor in esophageal squamous cell carcinogenesis.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
18554506 2008 Characterization of four mammalian 3-hydroxyacyl-CoA dehydratases involved in very long-chain fatty acid synthesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.