Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.39
PubTator Score 0.57

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5VW00 B2RN42
Symbols WDR40C

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
16949367 Functionally characterizes other DDB1- and CUL4-associated factors, including the DCAF12 factor which most closely resembles the product of this gene.

AA Sequence

MAQQQTGSRKRKAPAVEAGAGSSSSQGLAAADGEGPLLPKKQKRPATRRRLVHYLKGREVGARGPAGLQG      1 - 70
FEGELRGYAVQRLPELLTERQLDLGTLNKVFASQWLNARQVVCGTKCNTLFVVDVQSGHITRIPLMRDKE     71 - 140
AGLAQAHQGCGIHAIELNPSKTLLATGGENPNSLAIYQLPTLDPLCLGDRHGHKDWIFAVAWLSDTVAVS    141 - 210
GSRDGTVALWRMDPDMFNGSIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRALAFSGKNQELGAV    211 - 280
SLDGYFHLWKARSTLSRLLSIRLPYCRENVCLTYCDELSLYAVGSQSHVSFLDPRQRQQNIRPLCSREGG    281 - 350
TGVRSLSFYQHIITVGTGHGSLLFYDIRAQKFLEERASSSLDSMPGPAGRKLKLACGRGWLNQDDVWVNY    351 - 420
FGGMGEFPNALYTHCYNWPEMKLFVAGGPLPSGLHGNYAGLWS                               421 - 463
//

Text Mined References (4)

PMID Year Title
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.