Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Gene RIF (1)

AA Sequence

MHGRAYLLLHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVV      1 - 70
KFITIPFHPNVDPHTGQPCIDFLDNPEKWNTNYTLSSILLALQVMLSNPVLENPVNLEAARILVKDESLY     71 - 140
RTILRLFNRPLQMKDDSQELPKDPRKCIRPIKTTSFSDYYQTWSRIATSKATEYYRTPLLKVPNFIGQYY    141 - 210
KWKKMDLQHQKEWNLKYSVIKCWLARKRMPHEVTHSMEEIKLCPTLIPTTDEIFLESPTAINSITDIYET    211 - 280
EEEGWKSDTSLYENDTDEPREEEVEDLISWTNTLNTNTSED                                 281 - 321
//

Text Mined References (9)

PMID Year Title