Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.19
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
urothelial carcinoma -1.100 0.023
glioblastoma -1.800 0.000
ependymoma -1.500 0.000
sonic hedgehog group medulloblastoma -1.500 0.000
atypical teratoid/rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -1.300 0.000
interstitial cystitis -1.400 0.000
pediatric high grade glioma -1.900 0.000
pilocytic astrocytoma -1.500 0.000
subependymal giant cell astrocytoma -2.025 0.008
Pick disease -1.300 0.001
pituitary cancer 2.000 0.000

Gene RIF (2)

PMID Text
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of GTPase activating Rap/RanGAP domain-like 3 (GARNL3) in U-937 macrophages
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVVDFCRRFVARSLCIILMKHFCSSSVSEDLGCRRGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGS      1 - 70
SDENATALPGTWRRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRA     71 - 140
ILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVNFKFGVLFA    141 - 210
KDGQLTDDEMFSNEIGSEPFQKFLNLLGDTITLKGWTGYRGGLDTKNDTTGIHSVYTVYQGHEIMFHVST    211 - 280
MLPYSKENKQQVERKRHIGNDIVTIVFQEGEESSPAFKPSMIRSHFTHIFALVRYNQQNDNYRLKIFSEE    281 - 350
SVPLFGPPLPTPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRRRTLDMLIRSLHQDLMPDLHKNML    351 - 420
NRRSFSDVLPESPKSARKKEEARQAEFVRIGQALKLKSIVRGDAPSSLAASGICKKEPWEPQCFCSNFPH    421 - 490
EAVCADPWGQALLVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDLLVLRADKGKDARLFVFRLSA    491 - 560
LQKGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKHNKPSGVTSTSLL    561 - 630
SPLSESPVEEFQYIREICLSDSPMVMTLVDGPAEESDNLICVAYRHQFDVVNESTGEAFRLHHVEANRVN    631 - 700
FVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDS    701 - 770
MEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATAAVNEVSSGGSSKGASARNSPQTPPGRDTPVFPSSL    771 - 840
GEGEIQSKNLYKIPLRNLVGRSIERPLKSPLVSKVITPPTPISVGLAAIPVTHSLSLSRMEIKEIASRTR    841 - 910
RELLGLSDEGGPKSEGAPKAKSKPRKRLEESQGGPKPGAVRSSSSDRIPSGSLESASTSEANPEGHSASS    911 - 980
DQDPVADREGSPVSGSSPFQLTAFSDEDIIDLK                                         981 - 1013
//

Text Mined References (10)

PMID Year Title
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18711365 2008 Collaborative genome-wide association analysis supports a role for ANK3 and CACNA1C in bipolar disorder.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.