Knowledge Summary

Patent

No data available

Synonym

Accession Q5VVS0 Q6ZR57
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MTQNSSSLGDRIITPYTPPRSQPMNKHLFVSLSTLFQTTELDFANKKSCFLCLPLRADGFPEMPHSPAQT      1 - 70
ERMQKLAKDPPHARSEDVPDHLFFVDTAGLREIVCFCGVLSLRTSEGLMRKETA                     71 - 124
//

Text Mined References (3)

PMID Year Title