Knowledge Summary

Patent

No data available

Synonym

Accession Q5VVS0 Q6ZR57
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MTQNSSSLGDRIITPYTPPRSQPMNKHLFVSLSTLFQTTELDFANKKSCFLCLPLRADGFPEMPHSPAQT      1 - 70
ERMQKLAKDPPHARSEDVPDHLFFVDTAGLREIVCFCGVLSLRTSEGLMRKETA                     71 - 124
//

Text Mined References (3)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.