Property Summary

NCBI Gene PubMed Count 9
PubMed Score 37.12
PubTator Score 7.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession Q5VVQ6 B2RNX3 Q5VVQ5 Q6ZRS6 Q86T63 Q9P1L8
Symbols DUBA8
OTUD2
PRO0907

Gene

PANTHER Protein Class (2)

PDB

4BOS   4BOZ   4BOQ  

Gene RIF (3)

PMID Text
26463207 activity of the p97-associated deubiquitinylase YOD1 is also required for substrate disposal
25747718 miR-373 increases proliferation by directly targeting YOD1 in cervical cancer.
19818707 The assignment of a p97-associated ubiquitin processing function to YOD1 adds to our understanding of p97's role in the dislocation of misfolded proteins from the endoplasmic reticulum.

AA Sequence

MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVR      1 - 70
ELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASS     71 - 140
YVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYC    141 - 210
DWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDT    211 - 280
PPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV      281 - 348
//

Text Mined References (13)

PMID Year Title
26463207 2015 The VCP/p97 and YOD1 Proteins Have Different Substrate-dependent Activities in Endoplasmic Reticulum-associated Degradation (ERAD).
25747718 2015 MicroRNA-373 functions as an oncogene and targets YOD1 gene in cervical cancer.
24068323 2013 A deubiquitinase negatively regulates retro-translocation of nonubiquitinated substrates.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
21376232 2011 PARIS (ZNF746) repression of PGC-1? contributes to neurodegeneration in Parkinson's disease.
21269460 2011 Initial characterization of the human central proteome.
19818707 2009 The otubain YOD1 is a deubiquitinating enzyme that associates with p97 to facilitate protein dislocation from the ER.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...