Property Summary

NCBI Gene PubMed Count 11
PubMed Score 39.78
PubTator Score 7.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis -1.600 1.9e-04
diabetes mellitus 1.700 1.5e-03
group 4 medulloblastoma 1.800 3.4e-05
intraductal papillary-mucinous adenoma (... 1.700 1.6e-03
intraductal papillary-mucinous carcinoma... 1.500 5.2e-03
intraductal papillary-mucinous neoplasm ... 2.600 7.6e-04
lung cancer 1.300 3.6e-03
medulloblastoma, large-cell 1.800 2.4e-05
osteosarcoma -2.580 2.3e-04
pancreatic cancer 1.200 2.0e-05
periodontitis -1.200 3.4e-28
Pneumonia 1.800 3.4e-02
psoriasis 2.100 2.9e-06
spina bifida -2.856 4.0e-02
tuberculosis and treatment for 3 months 1.100 5.8e-04

Gene RIF (5)

AA Sequence

MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVR      1 - 70
ELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASS     71 - 140
YVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYC    141 - 210
DWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDT    211 - 280
PPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV      281 - 348
//

Text Mined References (15)

PMID Year Title