Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.22
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 1.800 0.000
medulloblastoma, large-cell -1.100 0.006
ovarian cancer 1.200 0.000

Gene RIF (1)

PMID Text
16710767 A novel human prefoldin PFD6L from the fetal brain was cloned and characterized.

AA Sequence

MSQEKNEMFESEWSKEREREKQLASGLDTAEKALKVESEELQKSKSELICLYNEVHNLPGESESKDHFLI      1 - 70
ACDLLQRENSELETKVLKLSQEFAQLNHFTLGGKTAPSNLITSENTCKDPESNEPILETEIQSRKEETEE     71 - 140
LCPKLGERKQKEIPEESVKEGSFPREGQKEEGSQQNRDMKDEEKEQQLTMKPEEIVRLREELSHINQSLL    141 - 210
QSQSSGDSSDDSGAQHPSSGEKLKYNQQGEVQQLHQNLHRLQILCNSAENELRYERGQNLDLKQHNSLLQ    211 - 280
EENIKIKIELKHAQQKLLDSTKMCSSLTAEYKHCQQKIKELELEVLKHTQSIKSQNNLQEKLVQEKSKVA    281 - 350
DAEEKILDLQRKLEHAHKVCLTDTCISEKQQLEEKIKEATQNEAKVKQQYQEEQQKRKLLYQNVDELHRQ    351 - 420
VRTLQDKENLLEMTCSQQQSRIQQQEALLKQLENEKRKYDEHVKSNQELSEKLSKLQQEKEALREEYLRL    421 - 490
LKLLNVHVRNYNEKHHQQKVKLQKVKYRLTNEVELRDKRINQFEDEIGILQHKIEKEKAIQDQITAQNDT    491 - 560
LLLEKRKLQEQVIEQEQLIHSNKWTISSIQSRVLYMDKENKQLQENSLRLTQQIGFLERIIRSIHIRRGE    561 - 630
NLKEFPVPKWWHRGKLASLPPTKKQKEIYSTEVFTSNNAELQHEDESVPEATEKWKHSEQMETTISDILE    631 - 700
SEVVNEILPLSNSSFSGKGLVESFASLQETEEIKSKEAMASSKSPEKSPENLVCSQNSEAGYINVASLKE    701 - 770
THGIQEQDQKSEL                                                             771 - 783
//

Text Mined References (3)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
16710767 2006 Cloning and characterization of a novel human prefoldin and SPEC domain protein gene (PFD6L) from the fetal brain.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.