Property Summary

NCBI Gene PubMed Count 11
PubMed Score 62.14
PubTator Score 7.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Alzheimer's disease -1.400 2.7e-02
atypical teratoid / rhabdoid tumor 1.100 6.4e-05
gastric cancer -1.100 3.1e-02
glioblastoma 1.200 8.2e-04
group 4 medulloblastoma 1.200 1.9e-02
hereditary spastic paraplegia -1.004 2.1e-02
juvenile dermatomyositis 1.070 1.7e-08
medulloblastoma, large-cell 1.800 1.6e-05
Pick disease -2.200 1.1e-06
progressive supranuclear palsy -1.500 2.1e-02
tuberculosis and treatment for 6 months 1.500 7.4e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MAAEEADVDIEGDVVAAAGAQPGSGENTASVLQKDHYLDSSWRTENGLIPWTLDNTISEENRAVIEKMLL      1 - 70
EEEYYLSKKSQPEKVWLDQKEDDKKYMKSLQKTAKIMVHSPTKPASYSVKWTIEEKELFEQGLAKFGRRW     71 - 140
TKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTGHNLQVKNEDKGTKAWTPSCLRGRADPNLN    141 - 210
AVKIEKLSDDEEVDITDEVDELSSQTPQKNSSSDLLLDFPNSKMHETNQGEFITSDSQEALFSKSSRGCL    211 - 280
QNEKQDETLSSSEITLWTEKQSNGDKKSIELNDQKFNELIKNCNKHDGRGIIVDARQLPSPEPCEIQKNL    281 - 350
NDNEMLFHSCQMVEESHEEEELKPPEQEIEIDRNIIQEEEKQAIPEFFEGRQAKTPERYLKIRNYILDQW    351 - 420
EICKPKYLNKTSVRPGLKNCGDVNCIGRIHTYLELIGAINFGCEQAVYNRPQTVDKVRIRDRKDAVEAYQ    421 - 490
LAQRLQSMRTRRRRVRDPWGNWCDAKDLEGQTFEHLSAEELAKRREEEKGRPVKSLKVPRPTKSSFDPFQ    491 - 560
LIPCNFFSEEKQEPFQVKVASEALLIMDLHAHVSMAEVIGLLGGRYSEVDKVVEVCAAEPCNSLSTGLQC    561 - 630
EMDPVSQTQASETLAVRGFSVIGWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAKFIGMIVSPYNRNNP    631 - 700
LPYSQITCLVISEEISPDGSYRLPYKFEVQQMLEEPQWGLVFEKTRWIIEKYRLSHSSVPMDKIFRRDSD    701 - 770
LTCLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEENCTKELLM                771 - 828
//

Text Mined References (18)

PMID Year Title