Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAESGKEKIKWTTTIIISSSLKSYEVATALENRSHKVRYSDSVENGSIIFSLSGVAFLLMDTKECLLSTE      1 - 70
EIFLAKIEKFINIHQNSFLVLSAALHGPEEWKLMFRIQQRFLGCNLRILPVHNTVNAINLMCTIAKTTSK     71 - 140
PYIDSICYRMITAKAYIIEQSPVWKTLQKIKLNSDSVNPN                                  141 - 180
//

Text Mined References (4)

PMID Year Title