Property Summary

NCBI Gene PubMed Count 7
Grant Count 42
R01 Count 37
Funding $6,329,972.17
PubMed Score 2.52
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 2.700 0.000
astrocytoma -2.900 0.001
ependymoma -3.500 0.000
oligodendroglioma -2.000 0.016
glioblastoma -3.600 0.000
medulloblastoma -3.600 0.000
cystic fibrosis -1.148 0.001
atypical teratoid / rhabdoid tumor -4.000 0.000
medulloblastoma, large-cell -4.400 0.000
primitive neuroectodermal tumor -3.400 0.001
adrenocortical carcinoma -1.346 0.002
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -1.500 0.026
Pick disease -2.000 0.024
ovarian cancer -2.400 0.000
pituitary cancer 2.400 0.004

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18821597 Transgenic overexpression of Attractin-like-1 (Atrnl1), which compensates for loss of ATRN, does not rescue dark-like mutant phenotypes.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

METGGRARTGTPQPAAPGVWRARPAGGGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQSKPCERTGSCF      1 - 70
SGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFAT     71 - 140
ECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEVVTTSGYALLHFFSDAAYNLTGFNIFYSINS    141 - 210
CPNNCSGHGKCTTSVSVPSQVYCECDKYWKGEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDC    211 - 280
SLNVPSTESYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGTPSR    281 - 350
GPLQRYGHSLALYQENIFMYGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIME    351 - 420
LDSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKSIYVHGGYKAL    421 - 490
PGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTHNDTSLSNGAKCFSADFLAY    491 - 560
DIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSSVLLNDILVYKPPNCKAFRDEELCKNAGPG    561 - 630
IKCVWNKNHCESWESGNTNNILRAKCPPKTAASDDRCYRYADCASCTANTNGCQWCDDKKCISANSNCSM    631 - 700
SVKNYTKCHVRNEQICNKLTSCKSCSLNLNCQWDQRQQECQALPAHLCGEGWSHIGDACLRVNSSRENYD    701 - 770
NAKLYCYNLSGNLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGE    771 - 840
PNDSGFCAYLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTSNGMECMWCS    841 - 910
STKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTGRGHCIEGSSRGP    911 - 980
MKLIGMHHSEMVLDTNLCPKEKNYEWSFIQCPACQCNGHSTCINNNVCEQCKNLTTGKQCQDCMPGYYGD    981 - 1050
PTNGGQCTACTCSGHANICHLHTGKCFCTTKGIKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSL   1051 - 1120
LQEDDRHHTAINFIANPEQSNKNLDISINASNNFNLNITWSVGSTAGTISGEETSIVSKNNIKEYRDSFS   1121 - 1190
YEKFNFRSNPNITFYVYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWA   1191 - 1260
SRRREQLLRERQQMASRPFASVDVALEVGAEQTEFLRGPLEGAPKPIAIEPCAGNRAAVLTVFLCLPRGS   1261 - 1330
SGAPPPGQSGLAIASALIDISQQKASDSKDKTSGVRNRKHLSTRQGTCV                        1331 - 1379
//

Text Mined References (11)

PMID Year Title
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18821597 2008 Genetic and phenotypic studies of the dark-like mutant mouse.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14531729 2003 Characterization of a novel binding partner of the melanocortin-4 receptor: attractin-like protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
More...