Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.52
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.346 1.6e-03
adult high grade glioma -2.600 2.9e-03
astrocytic glioma -1.700 2.5e-03
Astrocytoma, Pilocytic -1.500 2.6e-02
atypical teratoid / rhabdoid tumor -4.000 8.8e-09
cystic fibrosis -1.148 9.1e-04
ependymoma -3.100 2.4e-03
glioblastoma -2.600 1.2e-06
group 4 medulloblastoma -3.000 6.2e-04
malignant mesothelioma 2.700 1.6e-06
medulloblastoma, large-cell -3.700 1.1e-03
oligodendroglioma -2.000 1.6e-02
ovarian cancer -2.400 1.3e-14
Pick disease -1.900 1.9e-02
pituitary cancer 1.200 1.5e-02
primitive neuroectodermal tumor -3.400 1.0e-03

Gene RIF (3)

AA Sequence

METGGRARTGTPQPAAPGVWRARPAGGGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQSKPCERTGSCF      1 - 70
SGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFAT     71 - 140
ECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEVVTTSGYALLHFFSDAAYNLTGFNIFYSINS    141 - 210
CPNNCSGHGKCTTSVSVPSQVYCECDKYWKGEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDC    211 - 280
SLNVPSTESYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGTPSR    281 - 350
GPLQRYGHSLALYQENIFMYGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIME    351 - 420
LDSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKSIYVHGGYKAL    421 - 490
PGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTHNDTSLSNGAKCFSADFLAY    491 - 560
DIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSSVLLNDILVYKPPNCKAFRDEELCKNAGPG    561 - 630
IKCVWNKNHCESWESGNTNNILRAKCPPKTAASDDRCYRYADCASCTANTNGCQWCDDKKCISANSNCSM    631 - 700
SVKNYTKCHVRNEQICNKLTSCKSCSLNLNCQWDQRQQECQALPAHLCGEGWSHIGDACLRVNSSRENYD    701 - 770
NAKLYCYNLSGNLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGE    771 - 840
PNDSGFCAYLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTSNGMECMWCS    841 - 910
STKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTGRGHCIEGSSRGP    911 - 980
MKLIGMHHSEMVLDTNLCPKEKNYEWSFIQCPACQCNGHSTCINNNVCEQCKNLTTGKQCQDCMPGYYGD    981 - 1050
PTNGGQCTACTCSGHANICHLHTGKCFCTTKGIKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSL   1051 - 1120
LQEDDRHHTAINFIANPEQSNKNLDISINASNNFNLNITWSVGSTAGTISGEETSIVSKNNIKEYRDSFS   1121 - 1190
YEKFNFRSNPNITFYVYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWA   1191 - 1260
SRRREQLLRERQQMASRPFASVDVALEVGAEQTEFLRGPLEGAPKPIAIEPCAGNRAAVLTVFLCLPRGS   1261 - 1330
SGAPPPGQSGLAIASALIDISQQKASDSKDKTSGVRNRKHLSTRQGTCV                        1331 - 1379
//

Text Mined References (11)

PMID Year Title