Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.17
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis and treatment for 6 months 409 1.7e-05
osteosarcoma 7950 4.9e-05
Disease Target Count Z-score Confidence
Disease of anatomical entity 32 0.0 1.3

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.229 4.9e-05
tuberculosis and treatment for 6 months -1.200 1.7e-05

AA Sequence

MSLCSPTHSAEMSLFLQGPEEMLPLSSEGSEMGSEKEQSPEPHLPEEGEGGKPWRVDDSEGSWIPPGEKE      1 - 70
HGQESLSDELQETHPKKPWQKVTVRARELGDPIAHPRHEADEKPFICAQCGKTFNNTSNLRTHQRIHTGE     71 - 140
KPYKCSECGKSFSRSSNRIRHERIHLEEKHYKCPKCQESFRRRSDLTTHQQDHLGKRPYRCDICGKSFSQ    141 - 210
SATLAVHHRTHLEPAPYICCECGKSFSNSSSFGVHHRTHTGERPYECTECGRTFSDISNFGAHQRTHRGE    211 - 280
KPYRCTVCGKHFSRSSNLKPFIPLWRMVLYSL                                          281 - 312
//

Text Mined References (12)

PMID Year Title