Property Summary

NCBI Gene PubMed Count 42
PubMed Score 44.88
PubTator Score 61.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Dyslexia 36
Disease Target Count P-value
pilocytic astrocytoma 3086 3.17601391944652E-14
lung carcinoma 2844 1.33901643476675E-12
atypical teratoid / rhabdoid tumor 4369 4.68512978730269E-10
pediatric high grade glioma 2712 1.44594657603378E-9
medulloblastoma, large-cell 6234 6.35239522195238E-9
medulloblastoma 1524 1.47467361684033E-8
malignant mesothelioma 3163 1.45035103489984E-7
glioblastoma 5572 1.08223021714185E-6
primitive neuroectodermal tumor 3031 2.1189120657986E-5
astrocytic glioma 2241 0.0012463865601126
oligodendroglioma 2849 0.0261937746171078
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Specific language impairment 31 4.63 2.3
Speech disorder 7 3.198 1.6
Apraxia 25 3.036 1.5
Disease Target Count
DYX2 1
Disease Target Count
Dyslexia 2 2

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
astrocytic glioma -2.400 0.001
oligodendroglioma -1.800 0.026
glioblastoma -3.200 0.000
medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -2.400 0.000
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -3.200 0.000
lung carcinoma 1.100 0.000

Synonym

Accession Q5VV43 A7MD37 B2RTU7 B4DHA7 B4DK75 B7ZML3 F5H123 Q9UJC8 Q9Y4G7
Symbols DYX2
NMIG
DYLX2

Gene

PDB

2E7M  

  Ortholog (11)

 GWAS Trait (1)

Gene RIF (37)

PMID Text
25230923 the association of DCDC2 and KIAA0319 with Developmental dyslexia in Chinese population should be further validated
25015435 our findings suggest that KIAA0319 is associated with a reading-related cognitive skill
24430574 KIAA0319 and ROBO1 genes, and developmental dyslexia (DD), related neuropsychological phenotypes and comorbid language and mathematical (dis)abilities in a large cohort of 493 Italian nuclear families ascertained through a proband with a diagnosis of DD.
23831424 These results indicate that KIAA0319L is the fourth of four candidate dyslexia susceptibility genes that is involved in neuronal migration, which supports the association of abnormal neuronal migration with developmental dyslexia.
23677054 This study demonstrated the association of developmental dyslexia with rs4504469 of KIAA0319 and not with any single-nucleotide polymorphisms of DCDC2.
23065966 results suggested that the 931C > T variant in KIAA0319, but not the -3G > A in DYX1C1, was significantly associated with the risk of dyslexia
22683091 The results of this study found that KIAA0319 gene contained polymorphisms that were significantly associated with white matter volume in the left temporo-parietal region and that white matter volume influenced reading ability.
22558177 Mutations in cilia co-expressed DCDC2, DYX1C1 and KIAA0319 genes are associated with a cognitive neurological disorder, dyslexia.
22326444 The Kiaa0319 plays a role in neuronal migration during embryonic development, and that early interference with this gene results in an array of behavioral deficits including impairments in rapid auditory processing and simple spatial learning.
22262880 The results of this study confirmed that both FOXP2 and KIAA0319/TTRAP/THEM2 genes play an important role in human language development, but probably through different cerebral pathways.
More...

AA Sequence

MAPPTGVLSSLLLLVTIAGCARKQCSEGRTYSNAVISPNLETTRIMRVSHTFPVVDCTAACCDLSSCDLA      1 - 70
WWFEGRCYLVSCPHKENCEPKKMGPIRSYLTFVLRPVQRPAQLLDYGDMMLNRGSPSGIWGDSPEDIRKD     71 - 140
LTFLGKDWGLEEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVGDSPAVPAETQ    141 - 210
QDPELHYLNESASTPAPKLPERSVLLPLPTTPSSGEVLEKEKASQLQEQSSNSSGKEVLMPSHSLPPASL    211 - 280
ELSSVTVEKSPVLTVTPGSTEHSIPTPPTSAAPSESTPSELPISPTTAPRTVKELTVSAGDNLIITLPDN    281 - 350
EVELKAFVAPAPPVETTYNYEWNLISHPTDYQGEIKQGHKQTLNLSQLSVGLYVFKVTVSSENAFGEGFV    351 - 420
NVTVKPARRVNLPPVAVVSPQLQELTLPLTSALIDGSQSTDDTEIVSYHWEEINGPFIEEKTSVDSPVLR    421 - 490
LSNLDPGNYSFRLTVTDSDGATNSTTAALIVNNAVDYPPVANAGPNHTITLPQNSITLNGNQSSDDHQIV    491 - 560
LYEWSLGPGSEGKHVVMQGVQTPYLHLSAMQEGDYTFQLKVTDSSRQQSTAVVTVIVQPENNRPPVAVAG    561 - 630
PDKELIFPVESATLDGSSSSDDHGIVFYHWEHVRGPSAVEMENIDKAIATVTGLQVGTYHFRLTVKDQQG    631 - 700
LSSTSTLTVAVKKENNSPPRARAGGRHVLVLPNNSITLDGSRSTDDQRIVSYLWIRDGQSPAAGDVIDGS    701 - 770
DHSVALQLTNLVEGVYTFHLRVTDSQGASDTDTATVEVQPDPRKSGLVELTLQVGVGQLTEQRKDTLVRQ    771 - 840
LAVLLNVLDSDIKVQKIRAHSDLSTVIVFYVQSRPPFKVLKAAEVARNLHMRLSKEKADFLLFKVLRVDT    841 - 910
AGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYIWDGESNCEWSIFYVTVLAFTLIVLTGGFTWLCICC    911 - 980
CKRQKRTKIRKKTKYTILDNMDEQERMELRPKYGIKHRSTEHNSSLMVSESEFDSDQDTIFSREKMERGN    981 - 1050
PKVSMNGSIRNGASFSYCSKDR                                                   1051 - 1072
//

Text Mined References (44)

PMID Year Title
25230923 2014 Association study of developmental dyslexia candidate genes DCDC2 and KIAA0319 in Chinese population.
25015435 2014 A common haplotype of KIAA0319 contributes to the phonological awareness skill in Chinese children.
24430574 2014 KIAA0319 and ROBO1: evidence on association with reading and pleiotropic effects on language and mathematics abilities in developmental dyslexia.
23831424 2013 Embryonic disruption of the candidate dyslexia susceptibility gene homolog Kiaa0319-like results in neuronal migration disorders.
23677054 2013 Analysis of genetic variants of dyslexia candidate genes KIAA0319 and DCDC2 in Indian population.
23065966 2012 Genetic variant in KIAA0319, but not in DYX1C1, is associated with risk of dyslexia: an integrated meta-analysis.
22683091 2012 Three dyslexia susceptibility genes, DYX1C1, DCDC2, and KIAA0319, affect temporo-parietal white matter structure.
22558177 2012 Exploring the transcriptome of ciliated cells using in silico dissection of human tissues.
22326444 2012 Neocortical disruption and behavioral impairments in rats following in utero RNAi of candidate dyslexia risk gene Kiaa0319.
22262880 2012 Genetic variants of FOXP2 and KIAA0319/TTRAP/THEM2 locus are associated with altered brain activation in distinct language-related regions.
More...