Property Summary

NCBI Gene PubMed Count 159
Grant Count 11
Funding $1,206,137.31
PubMed Score 63.71
PubTator Score 86.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
psoriasis -2.900 0.001
group 4 medulloblastoma 1.900 0.000
medulloblastoma, large-cell 2.900 0.002
lung cancer 1.100 0.006
breast carcinoma 1.300 0.010
pediatric high grade glioma 1.200 0.000

Gene RIF (155)

PMID Text
27049325 Risk alleles for 6 loci increased glucose levels from birth to 5 years of age (ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2
26563541 our data suggested that CDKAL1 gene variants have a significant effect on the response to anti-TNF therapies among Psoriasis patients
26168825 study identified the association between type 2 diabetes risk variants in CDKAL1 and birthweight in Chinese Han individuals, and the carrier of risk allele within SRR had the trend of reduced birthweight.
26119585 rs10946398 associated with markers of impaired insulin secretion
25961023 Messenger RNAs for three proteins AATK, SLC27A1, and CDKAL1 are preferentially secreted out in exosomes from HIV-1 Nef-expressing cells, and their targeting miRNAs (miR-32 and miR-93*) are retained in these cells
25785549 study found SNP rs7754840 in CDKAL1, rs864745 in JAZF1, and rs35767 in IGF1 might serve as potential susceptibility loci for type 2 diabetes in the Uyghur population
25723968 The rs7754840 and rs7756992 SNPs of the CDKAL1 gene were found to be associated with Gestational Diabetes Mellitus in this south Indian population.
25634229 Provide evidence against a role for dysregulated expression of CDKAL1-v1 in mediating the association between intronic SNPs in CDKAL1 and susceptibility to type 2 diabetes.
25483131 The results support a central role of CDKAL1 and TCF7L2 in T2DM susceptibility in Southwest Asian populations and provide a plausible component for understanding molecular mechanisms involved in the disease.
25370040 We observed novel selection signals in CDKAL1 and NEGR1, well-known diabetes and obesity susceptibility genes
More...

AA Sequence

MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRT      1 - 70
WGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVP     71 - 140
QAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKIRKNPLIEIISI    141 - 210
NTGCLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVE    211 - 280
VIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLK    281 - 350
EKVPGITIATDIICGFPGETDQDFQETVKLVEEYKFPSLFINQFYPRPGTPAAKMEQVPAQVKKQRTKDL    351 - 420
SRVFHSYSPYDHKIGERQQVLVTEESFDSKFYVAHNQFYEQVLVPKNPAFMGKMVEVDIYESGKHFMKGQ    421 - 490
PVSDAKVYTPSISKPLAKGEVSGLTKDFRNGLGNQLSSGSHTSAASQCDSASSRMVLPMPRLHQDCALRM    491 - 560
SVGLALLGLLFAFFVKVYN                                                       561 - 579
//

Text Mined References (164)

PMID Year Title
27049325 2016 Risk Alleles in/near ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2 Elevate Plasma Glucose Levels at Birth and in Early Childhood: Results from the FAMILY Study.
26563541 2015 CDKAL1 gene variants affect the anti-TNF response among Psoriasis patients.
26168825 2015 Positive Association Between Type 2 Diabetes Risk Alleles Near CDKAL1 and Reduced Birthweight in Chinese Han Individuals.
26119585 2015 The CDKAL1 gene is associated with impaired insulin secretion and glucose-related traits: the Cardiometabolic Risk in Chinese (CRC) study.
25785549 2015 The Uyghur population and genetic susceptibility to type 2 diabetes: potential role for variants in CDKAL1, JAZF1, and IGF1 genes.
25723968 2015 Identification of Genetic Variants of Gestational Diabetes in South Indians.
25634229 2015 A cautionary tale: the non-causal association between type 2 diabetes risk SNP, rs7756992, and levels of non-coding RNA, CDKAL1-v1.
25483131 2014 T2DM GWAS in the Lebanese population confirms the role of TCF7L2 and CDKAL1 in disease susceptibility.
25416956 2014 A proteome-scale map of the human interactome network.
25370040 2015 Novel genomic signals of recent selection in an Ethiopian population.
More...