Property Summary

NCBI Gene PubMed Count 7
Grant Count 4
Funding $166,831.51
PubMed Score 2.58
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (2)

PMID Text
24937664 OTU domain-containing protein 1 deubiquitinating enzyme is differentially expressed in thyroid cancer.
18854154 Knockdown of OTU domain containing 1 (OTUD1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MQLYSSVCTHYPAGAPGPTAAAPAPPAAATPFKVSLQPPGAAGAAPEPETGECQPAAAAEHREAAAVPAA      1 - 70
KMPAFSSCFEVVSGAAAPASAAAGPPGASCKPPLPPHYTSTAQITVRALGADRLLLHGPDPVPGAAGSAA     71 - 140
APRGRCLLLAPAPAAPVPPRRGSSAWLLEELLRPDCPEPAGLDATREGPDRNFRLSEHRQALAAAKHRGP    141 - 210
AATPGSPDPGPGPWGEEHLAERGPRGWERGGDRCDAPGGDAARRPDPEAEAPPAGSIEAAPSSAAEPVIV    211 - 280
SRSDPRDEKLALYLAEVEKQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADH    281 - 350
LDHFSPLIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRP    351 - 420
SIWLSWLSNGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSMAISLSKMYIEQNACS             421 - 481
//

Text Mined References (7)

PMID Year Title
24937664 2014 A putative OTU domain-containing protein 1 deubiquitinating enzyme is differentially expressed in thyroid cancer and identifies less-aggressive tumours.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23563609 2013 Genome-wide SNP and CNV analysis identifies common and low-frequency variants associated with severe early-onset obesity.
17991829 2007 DUBA: a deubiquitinase that regulates type I interferon production.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10664582 2000 A novel superfamily of predicted cysteine proteases from eukaryotes, viruses and Chlamydia pneumoniae.