Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q5VUY0 B3KXR9 Q5VUY1
Symbols

Gene

PANTHER Protein Class (2)

 GO Function (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MIFEKLRICSMPQFFCFMQDLPPLKYDPDVVVTDFRFGTIPVKLYQSKASTCTLKPGIVYYHGGGGVMGS      1 - 70
LKTHHGICSRLCKESDSVVLAVGYRKLPKHKFPVPVRDCLVATIHFLKSLDAYGVDPARVVVCGDSFGGA     71 - 140
IAAVVCQQLVDRPDLPRIRAQILIYAILQALDLQTPSFQQRKNIPLLTWSFICYCFFQNLDFSSSWQEVI    141 - 210
MKGAHLPAEVWEKYRKWLGPENIPERFKERGYQLKPHEPMNEAAYLEVSVVLDVMCSPLIAEDDIVSQLP    211 - 280
ETCIVSCEYDALRDNSLLYKKRLEDLGVPVTWHHMEDGFHGVLRTIDMSFLHFPCSMRILSALVQFVKGL    281 - 350
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.