Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.29
PubTator Score 0.20

Knowledge Summary

Patent

No data available

AA Sequence

MGNILTCRVHPSVSLEFDQQQGSVCPSESEIYEAGAEDRMAGAPMAAAVQPAEVTVEVGEDLHMHHVRDR      1 - 70
EMPEALEFNPSANPEASTIFQRNSQTDVVEIRRSNCTNHVSTVHFSQQYSLCSTIFLDDSTAIQHYLTMT     71 - 140
IISVTLEIPHHITQRDADRSLSIPDEQLHSFAVSTVHITKNRNGGGSLNNYSSSIPSTPSTSQEDPQFSV    141 - 210
PPTANTPTPVCKRSMRWSNLFTSEKGSDPDKERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTWKKK    211 - 280
YVTLCSNGVLTYYSSLGDYMKYIHKKEIDLQTSTIKVPGKWPSLATLACTPISSSKSDGLSKDMDTGLGD    281 - 350
SICFSPSISSTTIPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQTWHFEATTYEERDAWVQAIQSQIL    351 - 420
ASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNAHCVDCETQNPKWASLNLGVLMCIECSGIHRSLGTRL    421 - 490
SRVRSLELDDWPVELRKVMSSIGNDLANSIWEGSSQGRTKPTEKSTREEKERWIRSKYEEKLFLAPLPCT    491 - 560
ELSLGQQLLRATADEDLQTAILLLAHGSREEVNETCGEGDGCTALHLACRKGNVVLAQLLIWYGVDVMAR    561 - 630
DAHGNTALTYARQASSQECINVLLQYGCPDECV                                         631 - 663
//

Text Mined References (2)

PMID Year Title
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.