Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $135,285.75
PubMed Score 4.45
PubTator Score 1.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -1.138 0.031
group 3 medulloblastoma -2.500 0.000
periodontitis 1.100 0.000
medulloblastoma, large-cell -2.800 0.000
acute quadriplegic myopathy 1.107 0.000
sarcoidosis 1.200 0.037
diabetes mellitus 2.500 0.001
interstitial cystitis 1.500 0.001
primary Sjogren syndrome 1.100 0.005
spina bifida 1.385 0.037
invasive ductal carcinoma 1.100 0.015
ulcerative colitis 1.600 0.000
ovarian cancer -1.300 0.000
pituitary cancer -1.500 0.000

Gene RIF (1)

PMID Text
23385818 SFMBT2 may regulate cell growth via epigenetic regulation of HOXB13 gene expression in prostate cancer cells.

AA Sequence

MESTLSASNMQDPSSSPLEKCLGSANGNGDLDSEEGSSLEETGFNWGEYLEETGASAAPHTSFKHVEISI      1 - 70
QSNFQPGMKLEVANKNNPDTYWVATIITTCGQLLLLRYCGYGEDRRADFWCDVVIADLHPVGWCTQNNKV     71 - 140
LMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQNPFQYWIVSVIE    141 - 210
NVGGRLRLRYVGLEDTESYDQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAA    211 - 280
KFPLPMEVFKDHADLRSHFFTVGMKLETVNMCEPFYISPASVTKVFNNHFFQVTIDDLRPEPSKLSMLCH    281 - 350
ADSLGILPVQWCLKNGVSLTPPKGYSGQDFDWADYHKQHGAQEAPPFCFRNTSFSRGFTKNMKLEAVNPR    351 - 420
NPGELCVASVVSVKGRLMWLHLEGLQTPVPEVIVDVESMDIFPVGWCEANSYPLTAPHKTVSQKKRKIAV    421 - 490
VQPEKQLPPTVPVKKIPHDLCLFPHLDTTGTVNGKYCCPQLFINHRCFSGPYLNKGRIAELPQSVGPGKC    491 - 560
VLVLKEVLSMIINAAYKPGRVLRELQLVEDPHWNFQEETLKAKYRGKTYRAVVKIVRTSDQVANFCRRVC    561 - 630
AKLECCPNLFSPVLISENCPENCSIHTKTKYTYYYGKRKKISKPPIGESNPDSGHPKPARRRKRRKSIFV    631 - 700
QKKRRSSAVDFTAGSGEESEEEDADAMDDDTASEETGSELRDDQTDTSSAEVPSARPRRAVTLRSGSEPV    701 - 770
RRPPPERTRRGRGAPAASSAEEGEKCPPTKPEGTEDTKQEEEERLVLESNPLEWTVTDVVRFIKLTDCAP    771 - 840
LAKIFQEQDIDGQALLLLTLPTVQECMELKLGPAIKLCHQIERVKVAFYAQYAN                    841 - 894
//

Text Mined References (8)

PMID Year Title
23385818 2013 Regulation of DU145 prostate cancer cell growth by Scm-like with four mbt domains 2.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.