Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.00
PubTator Score 1.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.107 5.5e-06
diabetes mellitus 2.500 1.2e-03
group 3 medulloblastoma -2.500 3.3e-07
interstitial cystitis 1.500 8.7e-04
invasive ductal carcinoma 1.100 1.5e-02
medulloblastoma, large-cell -2.800 1.3e-06
osteosarcoma -1.138 3.1e-02
ovarian cancer -1.300 9.3e-05
periodontitis 1.100 1.6e-20
pituitary cancer -1.500 2.4e-05
primary Sjogren syndrome 1.100 4.6e-03
sarcoidosis 1.200 3.7e-02
spina bifida 1.385 3.7e-02
ulcerative colitis 1.600 2.6e-04

Gene RIF (1)

AA Sequence

MESTLSASNMQDPSSSPLEKCLGSANGNGDLDSEEGSSLEETGFNWGEYLEETGASAAPHTSFKHVEISI      1 - 70
QSNFQPGMKLEVANKNNPDTYWVATIITTCGQLLLLRYCGYGEDRRADFWCDVVIADLHPVGWCTQNNKV     71 - 140
LMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQNPFQYWIVSVIE    141 - 210
NVGGRLRLRYVGLEDTESYDQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAA    211 - 280
KFPLPMEVFKDHADLRSHFFTVGMKLETVNMCEPFYISPASVTKVFNNHFFQVTIDDLRPEPSKLSMLCH    281 - 350
ADSLGILPVQWCLKNGVSLTPPKGYSGQDFDWADYHKQHGAQEAPPFCFRNTSFSRGFTKNMKLEAVNPR    351 - 420
NPGELCVASVVSVKGRLMWLHLEGLQTPVPEVIVDVESMDIFPVGWCEANSYPLTAPHKTVSQKKRKIAV    421 - 490
VQPEKQLPPTVPVKKIPHDLCLFPHLDTTGTVNGKYCCPQLFINHRCFSGPYLNKGRIAELPQSVGPGKC    491 - 560
VLVLKEVLSMIINAAYKPGRVLRELQLVEDPHWNFQEETLKAKYRGKTYRAVVKIVRTSDQVANFCRRVC    561 - 630
AKLECCPNLFSPVLISENCPENCSIHTKTKYTYYYGKRKKISKPPIGESNPDSGHPKPARRRKRRKSIFV    631 - 700
QKKRRSSAVDFTAGSGEESEEEDADAMDDDTASEETGSELRDDQTDTSSAEVPSARPRRAVTLRSGSEPV    701 - 770
RRPPPERTRRGRGAPAASSAEEGEKCPPTKPEGTEDTKQEEEERLVLESNPLEWTVTDVVRFIKLTDCAP    771 - 840
LAKIFQEQDIDGQALLLLTLPTVQECMELKLGPAIKLCHQIERVKVAFYAQYAN                    841 - 894
//

Text Mined References (8)

PMID Year Title