Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.63
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.689 0.012
glioblastoma -1.700 0.004
group 4 medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.600 0.000
adult high grade glioma -1.700 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q5VUD6 Q5VUD7 Q8N5N0 Q8WYU5
Symbols pp6977
C9orf136

Gene

AA Sequence

MRRLRRLAHLVLFCPFSKRLQGRLPGLRVRCIFLAWLGVFAGSWLVYVHYSSYSERCRGHVCQVVICDQY      1 - 70
RKGIISGSVCQDLCELHMVEWRTCLSVAPGQQVYSGLWRDKDVTIKCGIEETLDSKARSDAAPRRELVLF     71 - 140
DKPTRGTSIKEFREMTLSFLKANLGDLPSLPALVGQVLLMADFNKDNRVSLAEAKSVWALLQRNEFLLLL    141 - 210
SLQEKEHASRLLGYCGDLYLTEGVPHGAWHAAALPPLLRPLLPPALQGALQQWLGPAWPWRAKIAIGLLE    211 - 280
FVEELFHGSYGTFYMCETTLANVGYTATYDFKMADLQQVAPEATVRRFLQGRRCEHSTDCTYGRDCRAPC    281 - 350
DRLMRQCKGDLIQPNLAKVCALLRGYLLPGAPADLREELGTQLRTCTTLSGLASQVEAHHSLVLSHLKTL    351 - 420
LWKKISNTKYS                                                               421 - 431
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23840464 2013 A novel predicted calcium-regulated kinase family implicated in neurological disorders.
21334309 2011 Characterisation of the FAM69 family of cysteine-rich endoplasmic reticulum proteins.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.