Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.63
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.700 4.5e-05
glioblastoma -1.700 3.9e-03
group 4 medulloblastoma -1.400 4.7e-04
medulloblastoma, large-cell -1.600 6.4e-05
osteosarcoma -1.689 1.2e-02
ovarian cancer 1.200 1.2e-05

AA Sequence

MRRLRRLAHLVLFCPFSKRLQGRLPGLRVRCIFLAWLGVFAGSWLVYVHYSSYSERCRGHVCQVVICDQY      1 - 70
RKGIISGSVCQDLCELHMVEWRTCLSVAPGQQVYSGLWRDKDVTIKCGIEETLDSKARSDAAPRRELVLF     71 - 140
DKPTRGTSIKEFREMTLSFLKANLGDLPSLPALVGQVLLMADFNKDNRVSLAEAKSVWALLQRNEFLLLL    141 - 210
SLQEKEHASRLLGYCGDLYLTEGVPHGAWHAAALPPLLRPLLPPALQGALQQWLGPAWPWRAKIAIGLLE    211 - 280
FVEELFHGSYGTFYMCETTLANVGYTATYDFKMADLQQVAPEATVRRFLQGRRCEHSTDCTYGRDCRAPC    281 - 350
DRLMRQCKGDLIQPNLAKVCALLRGYLLPGAPADLREELGTQLRTCTTLSGLASQVEAHHSLVLSHLKTL    351 - 420
LWKKISNTKYS                                                               421 - 431
//

Text Mined References (7)

PMID Year Title