Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.17
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8520 3.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 37 4.652 2.3
Azoospermia 110 3.61 1.8
Disease Target Count
Oculocerebrorenal syndrome 29

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.300 3.8e-02

Gene RIF (1)

AA Sequence

MAQQQTGSRKRKAPAVEADAESSPSQGLAAADGEGPLLLKRQRRPATYRSMAHYLKVREVGGWGPARLQG      1 - 70
FDGELRGYAVQRLPELLTERQLELGTVNKVFASQWLNSRQVVCGTKCNTLFVVDVESGHIARIPLLRDSE     71 - 140
ARLAQDQQGCGIHAIELNPSKTLLATGGENPNSLAIYQLPSLDPLCLGDRHGHKDWIFAVAWLSDTVAVS    141 - 210
GSRDGTVALWRMDPDKFDDTVAWHSEVGLPVYAHIRPRDVEAIPRAIINPSNRKVRALACGGKNQELGAV    211 - 280
SLDGYFHLWKAGSALSRLLSIRLPYFRDNVCLTYCDDMSVYAVGSHSHVSFLDLRQDQQNIRPLCSREGG    281 - 350
TGVRSLSFYRHIITVGTGQGSLLFYDVRAQKFLEERASATLESSSGPARRKLRLACGRGWLNHNDFWVNY    351 - 420
FGGMEVFPNALYTHCYNWPEMKLFVAGGPLPAGLHGNYAGLWS                               421 - 463
//

Text Mined References (5)

PMID Year Title