Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.95
PubTator Score 2.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 4.1e-03
Astrocytoma, Pilocytic -1.200 6.5e-04
atypical teratoid / rhabdoid tumor -1.300 2.7e-05
diabetes mellitus 1.200 1.0e-03
glioblastoma -1.100 9.4e-05
lung carcinoma 2.600 4.8e-25
medulloblastoma, large-cell -1.800 1.1e-04
ovarian cancer -1.400 2.0e-04
primitive neuroectodermal tumor -1.300 8.7e-04
psoriasis -2.000 2.5e-39

Gene RIF (4)

AA Sequence

MAEGSQSAPEAGNDMGNDDAIGGNVSKYIVLPTGYCGQPKKGHLIFDACFESGNLGRVDQVSEFEYDLFI      1 - 70
RPDTCNPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKSTSRPKWQRLPPKNVYYYRCP     71 - 140
DHRKNYVMSFAFCFDREEDIYQFAYCYPYTYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRKLDLLTITS    141 - 210
PDNLREGAEQKVVFITGRVHPGETPSSFVCQGIIDFLVSQHPIACVLREYLVFKIAPMLNPDGVYLGNYR    211 - 280
CSLMGFDLNRHWLDPSPWVHPTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQ    281 - 350
RQAIFPKLLCQNAEDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTE    351 - 420
EAYMKLGRNVARTFLDYYRLNPVVEKVAIPMPRLRNKEIEVQRRKEKSPPYKHPLLRGPASNYPNSKGDK    421 - 490
KSSVNHKDPSTPF                                                             491 - 503
//

Text Mined References (9)

PMID Year Title