Property Summary

NCBI Gene PubMed Count 18
Grant Count 114
R01 Count 88
Funding $11,294,079.36
PubMed Score 346.85
PubTator Score 100.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PANTHER Protein Class (2)

Gene RIF (10)

PMID Text
26334609 Data suggest that substrate specificity of hedgehog acyltransferase (HHAT) in palmitoylation reaction extends to oligopeptide fragments of Sonic hedgehog protein (SHH).
25889650 Hhat plays a critical role in ER positive, HER2 amplified, and hormone resistant breast cancer proliferation.
25849925 three distinct members [porcupine (PORCN), hedgehog (Hh) acyltransferase (HHAT) and ghrelin O-acyltransferase (GOAT)] have been shown to acylate specific proteins or peptides.
25488661 analysis of hedgehog acyltransferase membrane topology
24784881 provide the first clinical evidence of the essential role played by lipid modification of Hh proteins in human testicular organogenesis and embryonic development
23142968 rs7527939 is the strongest indicator of susceptibility to schizophrenia in the Bulgarian population within the HHAT locus.
23112049 These findings define residues and regions within Shh that are necessary for its recognition as a substrate for Hhat-mediated palmitoylation.
22733134 SKN is necessary for the proliferation of the non-small cell lung carcinoma cells
22626636 SKI-1/S1P activity is thus essential for hepatitis C virus production and its inhibition should be considered for antiviral drug development.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEWGKQW      1 - 70
LVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLHTTISFCVAQFRSQLLTWLCS     71 - 140
LLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYYTSFSLELCWQQLPAASTSYSFPWMLAYVFY    141 - 210
YPVLHNGPILSFSEFIKQMQQQEHDSLKASLCVLALGLGRLLCWWWLAELMAHLMYMHAIYSSIPLLETV    211 - 280
SCWTLGGLALAQVLFFYVKYLVLFGVPALLMRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHNFLIRYV    281 - 350
YIPVGGSQHGLLGTLFSTAMTFAFVSYWHGGYDYLWCWAALNWLGVTVENGVRRLVETPCIQDSLARYFS    351 - 420
PQARRRFHAALASCSTSMLILSNLVFLGGNEVGKTYWNRIFIQGWPWVTLSVLGFLYCYSHVGIAWAQTY    421 - 490
ATD                                                                       491 - 493
//

Text Mined References (20)

PMID Year Title
26334609 2015 Click chemistry armed enzyme-linked immunosorbent assay to measure palmitoylation by hedgehog acyltransferase.
25889650 2015 Hedgehog Acyltransferase as a target in estrogen receptor positive, HER2 amplified, and tamoxifen resistant breast cancer cells.
25849925 2015 Membrane bound O-acyltransferases and their inhibitors.
25505265 2015 Topological analysis of Hedgehog acyltransferase, a multipalmitoylated transmembrane protein.
25488661 2015 Membrane topology of hedgehog acyltransferase.
24784881 2014 Loss of function mutation in the palmitoyl-transferase HHAT leads to syndromic 46,XY disorder of sex development by impeding Hedgehog protein palmitoylation and signaling.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23142968 2013 Whole-genome-wide association study in the Bulgarian population reveals HHAT as schizophrenia susceptibility gene.
23112049 2012 Identification of N-terminal residues of Sonic Hedgehog important for palmitoylation by Hedgehog acyltransferase.
22733134 2013 The hedgehog processing pathway is required for NSCLC growth and survival.
More...