Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 3.4e-15
diabetes mellitus 1728 1.4e-03
breast carcinoma 1638 2.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.300 2.8e-02
diabetes mellitus -1.100 1.4e-03
lung adenocarcinoma 1.400 3.4e-15

AA Sequence

MVAYWRQAGLSYIRYSQICAKVVRDALKTEFKANAKKTSGNSVKIVKVKKE                         1 - 51
//

Text Mined References (3)

PMID Year Title