Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 3.43053485268424E-15
diabetes mellitus 1663 0.00135762759091638
breast carcinoma 1614 0.0284564581240056

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.300 0.028
diabetes mellitus -1.100 0.001
lung adenocarcinoma 1.400 0.000

Synonym

Accession Q5VTU8
Symbols

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MVAYWRQAGLSYIRYSQICAKVVRDALKTEFKANAKKTSGNSVKIVKVKKE                         1 - 51
//

Text Mined References (3)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
15057823 2004 The DNA sequence and analysis of human chromosome 13.