Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic -1.400 3.5e-05
atypical teratoid / rhabdoid tumor 1.200 1.7e-02
Endometriosis -1.113 4.3e-02
facioscapulohumeral dystrophy 3.500 3.3e-07
group 3 medulloblastoma -1.500 1.7e-02
lung carcinoma 1.200 1.1e-03
medulloblastoma, large-cell -1.400 1.2e-02
nasopharyngeal carcinoma -3.500 1.6e-07
posterior fossa group B ependymoma 1.200 4.9e-03

Gene RIF (2)

AA Sequence

MDSLDRSCQDWCDRKQHWLEIGPPDLVERKGSLTLRSHHKKYSKPVLVYSWHRDREAFPKGYDIEGPEKV      1 - 70
KKLCNSTYRRLGTDESPIWTSETHEKLSQMCLNTEWVEMKSKALLNEETVSSGIIERVTGLPATGFGAVF     71 - 140
PRHPPDWSKMCALTTYSEDYVPPYDYQPHAYPCQDDYSIVHRKCRSQFTDLNGSKRFGINTWHDESGIYA    141 - 210
NSDVKQKLYPLTSGPIVPI                                                       211 - 229
//

Text Mined References (8)

PMID Year Title