Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
R01 Count 1
Funding $200,000
PubMed Score 1.71
PubTator Score 1.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.800 0.013
ependymoma -1.700 0.000
oligodendroglioma -1.400 0.049
osteosarcoma -1.343 0.001
glioblastoma -1.800 0.000
medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -3.400 0.000
primitive neuroectodermal tumor -1.500 0.002
tuberculosis 1.600 0.000
intraductal papillary-mucinous carcinoma... 1.700 0.046
pediatric high grade glioma -1.300 0.003

Gene RIF (6)

PMID Text
25920552 Two new polymorphisms associated with gall bladder disease and obesity in women have been identified, GCKR rs1260326, and TTC39B rs686030.
20972250 Observational study of gene-disease association. (HuGE Navigator)
20686565 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19060906 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MDAVLACRLRGRGNRVAALRPRPRPGGSAGPSPFALLCAGLSPEPRAGVGSEFPAWFLGGSSQRRNMALL      1 - 70
GSRAELEADEDVFEDALETISISSHSDMATSSLHFASCDTQQAPRQRGASTVSSSSSTKVDLKSGLEECA     71 - 140
VALNLFLSNKFTDALELLRPWAKESMYHALGYSTIVVLQAVLTFEQQDIQNGISAMKDALQTCQKYRKKY    141 - 210
TVVESFSSLLSRGSLEQLSEEEMHAEICYAECLLQKAALTFVQDENMINFIKGGLKIRTSYQIYKECLSI    211 - 280
LHEIQKNKLQQEFFYEFEGGVKLGSGAFNLMLSLLPARIIRLLEFIGFSGNRELGLLQLREGASGRSMRS    281 - 350
ALCCLTILAFHTYISLILGTGEVNVAEAERLLAPFLQQFPNGSLVLFYHARIELLKGNLEEAQEVFQKCI    351 - 420
SVQEEWKQFHHLCYWELMWINVFQQNWMQAYYYSDLLCKESKWSKATYVFLKAAILSMLPEEDVVATNEN    421 - 490
VVTLFRQVDSLKQRIAGKSIPTEKFAVRKARRYSASLPAPVKLILPALEMMYVWNGFSIVSKRKDLSENL    491 - 560
LVTVEKAEAALQSQNFNSFSVDDECLVKLLKGCCLKNLQRPLQAELCYNHVVESEKLLKYDHYLVPFTLF    561 - 630
ELASLYKSQGEIDKAIKFLETARNNYKDYSLESRLHFRIQAALHLWRKPSSD                      631 - 682
//

Text Mined References (17)

PMID Year Title
25920552 2016 Lipids, obesity and gallbladder disease in women: insights from genetic studies using the cardiovascular gene-centric 50K SNP array.
25416956 2014 A proteome-scale map of the human interactome network.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
More...