Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.88
PubTator Score 1.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 4.5e-02
astrocytic glioma -1.800 1.3e-02
atypical teratoid / rhabdoid tumor -2.500 7.8e-07
ependymoma -1.600 4.1e-02
glioblastoma -1.100 3.5e-03
group 4 medulloblastoma -2.300 2.8e-04
intraductal papillary-mucinous carcinoma... 1.700 4.6e-02
medulloblastoma, large-cell -3.400 2.0e-06
oligodendroglioma -1.400 4.9e-02
osteosarcoma -1.343 8.1e-04
primitive neuroectodermal tumor -1.500 1.6e-03
tuberculosis 1.600 5.9e-05

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MDAVLACRLRGRGNRVAALRPRPRPGGSAGPSPFALLCAGLSPEPRAGVGSEFPAWFLGGSSQRRNMALL      1 - 70
GSRAELEADEDVFEDALETISISSHSDMATSSLHFASCDTQQAPRQRGASTVSSSSSTKVDLKSGLEECA     71 - 140
VALNLFLSNKFTDALELLRPWAKESMYHALGYSTIVVLQAVLTFEQQDIQNGISAMKDALQTCQKYRKKY    141 - 210
TVVESFSSLLSRGSLEQLSEEEMHAEICYAECLLQKAALTFVQDENMINFIKGGLKIRTSYQIYKECLSI    211 - 280
LHEIQKNKLQQEFFYEFEGGVKLGSGAFNLMLSLLPARIIRLLEFIGFSGNRELGLLQLREGASGRSMRS    281 - 350
ALCCLTILAFHTYISLILGTGEVNVAEAERLLAPFLQQFPNGSLVLFYHARIELLKGNLEEAQEVFQKCI    351 - 420
SVQEEWKQFHHLCYWELMWINVFQQNWMQAYYYSDLLCKESKWSKATYVFLKAAILSMLPEEDVVATNEN    421 - 490
VVTLFRQVDSLKQRIAGKSIPTEKFAVRKARRYSASLPAPVKLILPALEMMYVWNGFSIVSKRKDLSENL    491 - 560
LVTVEKAEAALQSQNFNSFSVDDECLVKLLKGCCLKNLQRPLQAELCYNHVVESEKLLKYDHYLVPFTLF    561 - 630
ELASLYKSQGEIDKAIKFLETARNNYKDYSLESRLHFRIQAALHLWRKPSSD                      631 - 682
//

Text Mined References (17)

PMID Year Title