Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 3.91370278171384E-14
non-small cell lung cancer 2798 2.35715071640828E-12
juvenile dermatomyositis 1189 3.10740843259768E-10
ovarian cancer 8492 2.57677777002784E-9
acute quadriplegic myopathy 1157 8.75275652931627E-9
osteosarcoma 7933 3.56499545468101E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 7.47126603628669E-4
Pick disease 1893 9.70440292687666E-4
astrocytic glioma 2241 0.0014654043068931
primitive neuroectodermal tumor 3031 0.00183312264933973
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00234432041840978
oligodendroglioma 2849 0.00285840147747608
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00393312244472558
ependymoma 2514 0.0044100807277363
non primary Sjogren syndrome sicca 840 0.010060902832687
adult high grade glioma 2148 0.0366501985074091

Expression

Synonym

Gene

  Ortholog (10)

 MGI Term (1)

Gene RIF (1)

PMID Text
19460752 Knockdown of PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MANNSPALTGNSQPQHQAAAAAAQQQQQCGGGGATKPAVSGKQGNVLPLWGNEKTMNLNPMILTNILSSP      1 - 70
YFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKL     71 - 140
TRKQVMGLITHTDSPYIRALGFMYIRYTQPPTDLWDWFESFLDDEEDLDVKAGGGCVMTIGEMLRSFLTK    141 - 210
LEWFSTLFPRIPVPVQKNIDQQIKTRPRKIKKDGKEGAEEIDRHVERRRSRSPRRSLSPRRSPRRSRSRS    211 - 280
HHREGHGSSSFDRELEREKERQRLEREAKEREKERRRSRSIDRGLERRRSRSRERHRSRSRSRDRKGDRR    281 - 350
DRDREREKENERGRRRDRDYDKERGNEREKERERSRERSKEQRSRGEVEEKKHKEDKDDRRHRDDKRDSK    351 - 420
KEKKHSRSRSRERKHRSRSRSRNAGKRSRSRSKEKSSKHKNESKEKSNKRSRSGSQGRTDSVEKSKKREH    421 - 490
SPSKEKSRKRSRSKERSHKRDHSDSKDQSDKHDRRRSQSIEQESQEKQHKNKDETV                  491 - 546
//

Text Mined References (20)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
More...