Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.33
PubTator Score 5.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 8.47693239615936E-15
lung adenocarcinoma 2714 1.15967977961489E-9
pituitary cancer 1972 1.8589953756863E-9
ulcerative colitis 2087 5.42875104561149E-9
malignant mesothelioma 3163 4.11553017511202E-7
nasopharyngeal carcinoma 1056 7.92843209607079E-6
atypical teratoid / rhabdoid tumor 4369 2.07009906695143E-4
adult high grade glioma 2148 0.0040624982438878
glioblastoma 5572 0.00481279038258558
colon cancer 1475 0.00505526183158337
chronic rhinosinusitis 512 0.0434026187302842
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 1.0
Disease Target Count Z-score Confidence
Esophageal varix 10 3.373 1.7

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -2.200 0.000
posterior fossa group B ependymoma 4.500 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.100 0.005
colon cancer -2.600 0.005
ulcerative colitis -2.800 0.000
lung adenocarcinoma -1.300 0.000
adult high grade glioma 1.100 0.004
nasopharyngeal carcinoma -2.600 0.000
pituitary cancer 1.700 0.000
chronic rhinosinusitis -2.149 0.043

Synonym

Accession Q5VTH9 A8K9W5 B5MDT3 H7BY80 Q5VTI0 Q8N5G5 Q9H5R9 Q9UF44
Symbols DIC4

Gene

  Ortholog (9)

AA Sequence

MTPGKHSGASARAANGGAWGYRDFRGGQKKGWCTTPQLVATMPVSPAGSHKQQNFGLNNATQPKKSISFF      1 - 70
ATMKATSVKGYTGANQSRMAVSKTVLIPPELKTVEKPNPNIKTTQVFDINGTDVTPRPLYHPDPLTGTAK     71 - 140
PSKLLTSQEGSLGSEFISSYSLYQNTINPSTLGQFTRSVLGSSTVSKSSVSASESIAEDLEEPSYKRERL    141 - 210
TSFTDLQVIRAAPEKIVTKEDLEKNIEIILTETETLRFFDLPTVMVSVESEEAEKVTQRNKNYEVLCRNR    211 - 280
LGNDLYVERMMQTFNGAPKNKDVQCDKIIMEDKGIMSTAWDLYDSYNAMELVSLSVKQSVVESSSKANVL    281 - 350
PKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLFFMERVLMENIFQPKL    351 - 420
AAYRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSS    421 - 490
LAWNKTNPDLLAVGYGHFGFKEQKRGLACCWSIKNPMWPERIYQSPYGVTAVDFSIGAPNLLAVGYHNGT    491 - 560
IAIYNVRSNSNVPVLDSSESPQKHLGPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDCY    561 - 630
DLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKDTNIYLAGTEEGHIHKCSCSYNEQYLDTY    631 - 700
RGHKGPVYKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFYPATSVVYDVAWSPKSSYIFAAANENR    701 - 770
VEIWDLHISTLDPLIVNTANPGIKFTTILFAKQTDCLLVGDSDGQVSVYELRNMPTVLETGRGDIMDTLL    771 - 840
GSKSNQSA                                                                  841 - 848
//

Text Mined References (8)

PMID Year Title
21953912 2011 A unified taxonomy for ciliary dyneins.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.