Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.33
PubTator Score 5.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis -1.238 4.8e-02
adult high grade glioma 1.100 4.1e-03
atypical teratoid / rhabdoid tumor 1.400 1.2e-02
chronic rhinosinusitis -2.050 4.3e-02
colon cancer -2.600 5.1e-03
ependymoma 2.100 3.2e-02
glioblastoma 1.100 4.8e-03
lung adenocarcinoma -1.300 1.2e-09
malignant mesothelioma -2.200 4.1e-07
nasopharyngeal carcinoma -1.800 1.4e-04
pituitary cancer 1.400 6.2e-04

AA Sequence

MTPGKHSGASARAANGGAWGYRDFRGGQKKGWCTTPQLVATMPVSPAGSHKQQNFGLNNATQPKKSISFF      1 - 70
ATMKATSVKGYTGANQSRMAVSKTVLIPPELKTVEKPNPNIKTTQVFDINGTDVTPRPLYHPDPLTGTAK     71 - 140
PSKLLTSQEGSLGSEFISSYSLYQNTINPSTLGQFTRSVLGSSTVSKSSVSASESIAEDLEEPSYKRERL    141 - 210
TSFTDLQVIRAAPEKIVTKEDLEKNIEIILTETETLRFFDLPTVMVSVESEEAEKVTQRNKNYEVLCRNR    211 - 280
LGNDLYVERMMQTFNGAPKNKDVQCDKIIMEDKGIMSTAWDLYDSYNAMELVSLSVKQSVVESSSKANVL    281 - 350
PKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLFFMERVLMENIFQPKL    351 - 420
AAYRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSS    421 - 490
LAWNKTNPDLLAVGYGHFGFKEQKRGLACCWSIKNPMWPERIYQSPYGVTAVDFSIGAPNLLAVGYHNGT    491 - 560
IAIYNVRSNSNVPVLDSSESPQKHLGPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDCY    561 - 630
DLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKDTNIYLAGTEEGHIHKCSCSYNEQYLDTY    631 - 700
RGHKGPVYKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFYPATSVVYDVAWSPKSSYIFAAANENR    701 - 770
VEIWDLHISTLDPLIVNTANPGIKFTTILFAKQTDCLLVGDSDGQVSVYELRNMPTVLETGRGDIMDTLL    771 - 840
GSKSNQSA                                                                  841 - 848
//

Text Mined References (8)

PMID Year Title