Property Summary

NCBI Gene PubMed Count 4
PubMed Score 412.96
PubTator Score 3.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
Endometriosis -1.202 2.2e-02
ependymoma 3.600 4.6e-02
lung adenocarcinoma -1.100 3.0e-05
lung carcinoma -1.200 3.3e-03
nasopharyngeal carcinoma -2.400 5.3e-08
ovarian cancer 1.200 2.0e-02
Pick disease 2.000 3.7e-02
pituitary cancer -1.100 9.4e-05
sonic hedgehog group medulloblastoma -1.100 9.4e-04

AA Sequence

MATNYSANQYEKAFSSKYLQNWSPTKPTKESISSHEGYTQIIANDRGHLLPSVPRSKANPWGSFMGTWQM      1 - 70
PLKIPPARVTLTSRTTAGAASLTKWIQKNPDLLKASNGLCPEILGKPHDPDSQKKLRKKSITKTVQQARS     71 - 140
PTIIPSSPAANLNSPDELQSSHPSAGHTPGPQRPAKS                                     141 - 177
//

Text Mined References (5)

PMID Year Title