Property Summary

NCBI Gene PubMed Count 4
Grant Count 5
Funding $781,509
PubMed Score 390.41
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group B ependymoma 5.900 0.000
lung adenocarcinoma -1.100 0.000
sonic hedgehog group medulloblastoma -1.100 0.001
nasopharyngeal carcinoma -2.400 0.000
Endometriosis -1.202 0.022
lung carcinoma -1.200 0.003
Pick disease 2.000 0.037
ovarian cancer 1.200 0.020
pituitary cancer -1.100 0.000

Synonym

Accession Q5VTH2
Symbols Fltp
Flattop
C1orf192

Gene

AA Sequence

MATNYSANQYEKAFSSKYLQNWSPTKPTKESISSHEGYTQIIANDRGHLLPSVPRSKANPWGSFMGTWQM      1 - 70
PLKIPPARVTLTSRTTAGAASLTKWIQKNPDLLKASNGLCPEILGKPHDPDSQKKLRKKSITKTVQQARS     71 - 140
PTIIPSSPAANLNSPDELQSSHPSAGHTPGPQRPAKS                                     141 - 177
//

Text Mined References (5)

PMID Year Title
25296022 2014 Flattop regulates basal body docking and positioning in mono- and multiciliated cells.
22275255 2012 Increased gene dosage of myelin protein zero causes Charcot-Marie-Tooth disease.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.