Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.10
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.500 0.000
osteosarcoma -2.418 0.000
medulloblastoma, large-cell 1.200 0.002
Amyotrophic Lateral Sclerosis 1.012 0.000
tuberculosis -1.300 0.000
lung cancer 1.600 0.000
ductal carcinoma in situ 1.100 0.020
ovarian cancer -1.800 0.000

Synonym

Accession Q5VTE6 B7Z2U4 D3DTA3 Q86X13 Q8NHH3
Symbols Ccr4d
KIAA0759L

Gene

AA Sequence

MEAWRCVRKGYGHCVVGRGRYPMFPHHSRSLGRDWTTPWENLQRCCWNRHISSCMRWPGHYSRAPYPYFS      1 - 70
SRHFSLNWRPPCLFESRTQFQYCNWRPDNLSQTSLIHLSSYVMNAEGDEPSSKRRKHQGVIKRNWEYICS     71 - 140
HDKEKTKILGDKNVDPKCEDSENKFDFSVMSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKH    141 - 210
FDADVLCLQEVQEDHYGAEIRPSLESLGYHCEYKMRTGRKPDGCAICFKHSKFSLLSVNPVEFFRPDISL    211 - 280
LDRDNVGLVLLLQPKIPYAACPAICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGSFCPIVMCG    281 - 350
DFNSVPGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPKVEKT    351 - 420
DSDLTQTQLKQTEVLVTAEKLSSNLQHHFSLSSVYSHYFPDTGIPEVTTCHSRSAITVDYIFYSAEKEDV    421 - 490
AGHPGAEVALVGGLKLLARLSLLTEQDLWTVNGLPNENNSSDHLPLLAKFRLEL                    491 - 544
//

Text Mined References (7)

PMID Year Title
22547059 2012 RNA processing and modification protein, carbon catabolite repression 4 (Ccr4), arrests the cell cycle through p21-dependent and p53-independent pathway.
17178830 2007 An unconventional human Ccr4-Caf1 deadenylase complex in nuclear cajal bodies.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943475 2002 Genomic structure and evolutionary context of the human feline leukemia virus subgroup C receptor (hFLVCR) gene: evidence for block duplications and de novo gene formation within duplicons of the hFLVCR locus.