Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.10
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (8)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.012 1.8e-06
ductal carcinoma in situ 1.100 2.0e-02
lung cancer 1.600 2.9e-04
medulloblastoma, large-cell 1.200 1.7e-03
osteosarcoma -2.418 3.3e-10
ovarian cancer -1.800 4.2e-07
psoriasis -1.500 2.1e-04
tuberculosis -1.300 3.3e-08

Synonym

Accession Q5VTE6 B7Z2U4 D3DTA3 Q86X13 Q8NHH3
Symbols Ccr4d
KIAA0759L

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MEAWRCVRKGYGHCVVGRGRYPMFPHHSRSLGRDWTTPWENLQRCCWNRHISSCMRWPGHYSRAPYPYFS      1 - 70
SRHFSLNWRPPCLFESRTQFQYCNWRPDNLSQTSLIHLSSYVMNAEGDEPSSKRRKHQGVIKRNWEYICS     71 - 140
HDKEKTKILGDKNVDPKCEDSENKFDFSVMSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKH    141 - 210
FDADVLCLQEVQEDHYGAEIRPSLESLGYHCEYKMRTGRKPDGCAICFKHSKFSLLSVNPVEFFRPDISL    211 - 280
LDRDNVGLVLLLQPKIPYAACPAICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGSFCPIVMCG    281 - 350
DFNSVPGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPKVEKT    351 - 420
DSDLTQTQLKQTEVLVTAEKLSSNLQHHFSLSSVYSHYFPDTGIPEVTTCHSRSAITVDYIFYSAEKEDV    421 - 490
AGHPGAEVALVGGLKLLARLSLLTEQDLWTVNGLPNENNSSDHLPLLAKFRLEL                    491 - 544
//

Text Mined References (7)

PMID Year Title