Property Summary

NCBI Gene PubMed Count 4
Grant Count 109
R01 Count 69
Funding $15,026,431.95
PubMed Score 1274.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.611 1.8
Cutaneous anthrax 8 3.191 1.6

Synonym

Accession Q5VTE0 EF-1-alpha-like 3
Symbols EEF1AL3

Gene

AA Sequence

MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG      1 - 70
ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA     71 - 140
YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW    141 - 210
FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF    211 - 280
APVNVTTEVKSVEMHHEALSEALPGDNVGFKVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP    281 - 350
GQISAGYAPVLDCHMAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP    351 - 420
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK                                421 - 462
//

Text Mined References (5)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
15164053 2004 DNA sequence and analysis of human chromosome 9.
8812466 1996 Assignment of human elongation factor 1alpha genes: EEF1A maps to chromosome 6q14 and EEF1A2 to 20q13.3.