Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1183.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cataract 4 multiple types 14 3.948 2.0
Cancer 2499 3.659 1.8
Cutaneous anthrax 8 3.215 1.6

AA Sequence

MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG      1 - 70
ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA     71 - 140
YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW    141 - 210
FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF    211 - 280
APVNVTTEVKSVEMHHEALSEALPGDNVGFKVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP    281 - 350
GQISAGYAPVLDCHMAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP    351 - 420
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK                                421 - 462
//

Text Mined References (5)

PMID Year Title