Property Summary

NCBI Gene PubMed Count 3
Grant Count 2
Funding $69,149.34
PubMed Score 0.34
PubTator Score 0.40

Knowledge Summary

Patent (45)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
facioscapulohumeral dystrophy 286

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 1.800 0.050

Gene RIF (1)

PMID Text
26009545 Suggest that BK channel modulation by auxiliary gamma subunits depends on intra- and/or juxta-membrane mechanisms.

AA Sequence

MRPRAPACAAAALGLCSLLLLLAPGHACPAGCACTDPHTVDCRDRGLPSVPDPFPLDVRKLLVAGNRIQR      1 - 70
IPEDFFIFYGDLVYLDFRNNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLGAGAFRSAGRLVKLSLANNNL     71 - 140
VGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRSLRLDGNPWLCDCDFAHLFSWIQENASKLPK    141 - 210
GLDEIQCSLPMESRRISLRELSEASFSECRFSLSLTDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCA    211 - 280
PNKDAEDEDEDKDD                                                            281 - 294
//

Text Mined References (5)

PMID Year Title
26009545 2015 Molecular basis for differential modulation of BK channel voltage-dependent gating by auxiliary ? subunits.
22547800 2012 BK potassium channel modulation by leucine-rich repeat-containing proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.