Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.34
PubTator Score 0.40

Knowledge Summary

Patent (45)

TINX Plot

  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 5.0e-02

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 1.800 5.0e-02

Gene RIF (1)

AA Sequence

MRPRAPACAAAALGLCSLLLLLAPGHACPAGCACTDPHTVDCRDRGLPSVPDPFPLDVRKLLVAGNRIQR      1 - 70
IPEDFFIFYGDLVYLDFRNNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLGAGAFRSAGRLVKLSLANNNL     71 - 140
VGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRSLRLDGNPWLCDCDFAHLFSWIQENASKLPK    141 - 210
GLDEIQCSLPMESRRISLRELSEASFSECRFSLSLTDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCA    211 - 280
PNKDAEDEDEDKDD                                                            281 - 294
//

Text Mined References (5)

PMID Year Title