Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.42
PubTator Score 11.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Adenosquamous carcinoma 2 3.619 1.8

Synonym

Accession Q5VT79 A0A0B4J2D4 B2R939 Q53FY2 Q5VT78 Q96H89
Symbols ANXA8
ANXA8L2
VAC-beta
bA145E20.2

Gene

Gene RIF (1)

PMID Text
18223320 Claudin 18 and annexin A8 are frequently highly overexpressed in infiltrating ductal adenocarcinomas.

AA Sequence

MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKD      1 - 70
LTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYG     71 - 140
SSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSA    141 - 210
THLLRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNI    211 - 280
VSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP                           281 - 327
//

Text Mined References (14)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
18223320 2008 New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15928709 2005 Annexins: linking Ca2+ signalling to membrane dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11917092 2002 Annexins: from structure to function.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
More...