Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.66
PubTator Score 11.79

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKD      1 - 70
LTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYG     71 - 140
SSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSA    141 - 210
THLLRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNI    211 - 280
VSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP                           281 - 327
//

Text Mined References (14)

PMID Year Title