Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.67
PubTator Score 6.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
ductal carcinoma in situ -2.500 2.7e-04
group 3 medulloblastoma 1.200 1.4e-04
interstitial cystitis -1.100 2.9e-03
invasive ductal carcinoma -2.500 3.0e-03
medulloblastoma, large-cell 1.100 3.0e-05
osteosarcoma -2.464 3.7e-04
ovarian cancer 1.200 5.4e-07
psoriasis -1.400 4.5e-38
tuberculosis 2.300 1.2e-07

Gene RIF (9)

AA Sequence

MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCK      1 - 70
GVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKT     71 - 140
PTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDT    141 - 210
SPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDP    211 - 280
DTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ                 281 - 337
//

Text Mined References (23)

PMID Year Title