Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.55
PubTator Score 6.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -2.464 0.000
medulloblastoma, large-cell 1.100 0.000
tuberculosis 2.300 0.000
interstitial cystitis -1.100 0.003
group 3 medulloblastoma 1.200 0.000
ductal carcinoma in situ -2.500 0.000
invasive ductal carcinoma -2.500 0.003
ovarian cancer 1.200 0.000
psoriasis -1.400 0.000

Synonym

Gene

Gene RIF (9)

PMID Text
24500710 human mARC-1 and mARC-2 are capable of catalyzing reduction of nitrite to NO through reaction with its molybdenum cofactor
24423752 Functional characteristics of protein variants encoded by nonsynonymous single nucleotide polymorphisms in MARC1 and MARC2 in healthy Caucasians were determined.
23703616 Data indicate that mitochondrial amidoxime reducing components 1 and 2 together with the electron transport proteins NADH-cytochrome b5 reductase (CYB5R) and cytochrome b5 (CYB5) catalyze the reduction of N-hydroxylated compounds such as amidoximes.
23086957 The transmembrane domain of mARC1 shown to be sufficient for mitochondrial targeting and the N-terminal targeting signal to function as a supportive receptor for the outer mitochondrial membrane.
21803866 Chlamydomonas reinhardtii ARC has a Zn-dependent activity and protein partners similar to human MARC1 and MARC2.
21029045 results provide the first hints that mARC might be involved in mitochondrial N(omega)-hydroxy-L-arginine reduction and could be of physiological significance in affecting endogenous nitric oxide levels
20877624 Observational study of gene-disease association. (HuGE Navigator)
20861021 Arc1(MOSC-1) and Arc2(MOSC-2) proteins are monomeric in their active forms.
19053771 molybdoprotein mARC1 is involved in the activation of N-hydroxylated prodrugs.

AA Sequence

MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCK      1 - 70
GVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKT     71 - 140
PTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDT    141 - 210
SPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDP    211 - 280
DTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ                 281 - 337
//

Text Mined References (23)

PMID Year Title
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24500710 2014 Nitrite reductase and nitric-oxide synthase activity of the mitochondrial molybdopterin enzymes mARC1 and mARC2.
24423752 2014 Functional characterization of protein variants encoded by nonsynonymous single nucleotide polymorphisms in MARC1 and MARC2 in healthy Caucasians.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23703616 2013 The involvement of mitochondrial amidoxime reducing components 1 and 2 and mitochondrial cytochrome b5 in N-reductive metabolism in human cells.
23086957 2012 The mitochondrial amidoxime-reducing component (mARC1) is a novel signal-anchored protein of the outer mitochondrial membrane.
21803866 2011 The Chlamydomonas reinhardtii molybdenum cofactor enzyme crARC has a Zn-dependent activity and protein partners similar to those of its human homologue.
21493818 2011 Genetic and clinical correlates of early-outgrowth colony-forming units.
21326311 2011 Genome-wide association study identifies genetic variants influencing F-cell levels in sickle-cell patients.
More...