Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5VT33
Symbols CXorf31

 Compartment GO Term (1)

AA Sequence

MYRMKRSQVRTPIRRLIRNVNLDWEDSMALGCTTVIERGTLRRLKRATLNTFLDSPVHVLLVMPKLIPEH      1 - 70
WEKWEDVKR                                                                  71 - 79
//

Text Mined References (3)

PMID Year Title