Property Summary

Ligand Count 1
NCBI Gene PubMed Count 35
PubMed Score 25.39
PubTator Score 26.42

Knowledge Summary

Patent (4,932)

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia -1.500 5.0e-02
adult high grade glioma -1.100 7.2e-06
atypical teratoid / rhabdoid tumor -1.200 5.8e-05
dermatomyositis 1.300 4.5e-03
ependymoma -1.100 2.4e-03
glioblastoma -1.100 4.3e-03
group 4 medulloblastoma -1.700 6.4e-03
interstitial cystitis -1.100 1.2e-02
intraductal papillary-mucinous adenoma (... 1.400 5.2e-04
intraductal papillary-mucinous carcinoma... 1.900 5.0e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.1e-02
juvenile dermatomyositis 1.045 3.2e-05
lung adenocarcinoma 1.100 4.4e-06
lung carcinoma 1.700 6.7e-29
malignant mesothelioma -1.100 1.3e-05
medulloblastoma, large-cell -1.300 1.5e-04
osteosarcoma 2.752 2.9e-08
ovarian cancer -1.500 1.9e-03
pancreatic cancer 1.400 3.1e-03
pancreatic carcinoma 1.400 3.1e-03
psoriasis -1.800 7.3e-05

Gene RIF (12)

AA Sequence

MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQM      1 - 70
RLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTL     71 - 140
HYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMD    141 - 210
MNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGET    211 - 280
PFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDN    281 - 350
IRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTA    351 - 420
GPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTVDGPLTASKDLEIK    421 - 490
NLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTLQQEREDLNKELVQASERLKN    491 - 560
QSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKE    561 - 630
LEVHTEALAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFY    631 - 700
EEELSKREGIHANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKV    701 - 770
LLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQA    771 - 840
LASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIIT    841 - 910
ECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFERSPSCTPASKGR    911 - 980
RTVDSTPLSVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSC    981 - 1050
HITCVNKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAE   1051 - 1120
GKASQPSVVISQVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKN   1121 - 1190
KWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEII   1191 - 1260
RVGDNKKIHQIELIPNDQLVAVISGRNRHVRLFPMSALDGRETDFYKLSETKGCQTVTSGKVRHGALTCL   1261 - 1330
CVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAIFSEQLCVGFQSGFLRYPLNGEGNPYSMLHSNDH   1331 - 1400
TLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENAV   1401 - 1470
DIFDVNSMEWIQTLPLKKVRPLNNEGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINN   1471 - 1540
KRRYSFRVPEEERMQQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSG   1541 - 1610
SVSIPSITKSRPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYSAKRQPMPSPSEGSLSSGGMDQGSD   1611 - 1680
APARDFDGEDSDSPRHSTASNSSNLSSPPSPASPRKTKSLSLESTDRGSWDP                     1681 - 1732
//

Text Mined References (42)

PMID Year Title