Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.09

Knowledge Summary

Patent

No data available

AA Sequence

MEQPTSSINGEKRKSPCESNNENDEMQETPNRDLAPEPSLKKMKTSEYSTVLAFCYRKAKKIHSNQLEND      1 - 70
QS                                                                         71 - 72
//

Text Mined References (4)

PMID Year Title