Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5VSP4
Symbols LCN1L1
bA430N14.2

Gene

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MKPLLLAISLSLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDRELPEMNLESVTPMTLTILEGGNLEAK      1 - 70
ATMLISGQCQEVKVILEKTDEPGKYTANRGKHVAYIIRSHMKDHYIFYCEGRDPENNLEALEDFEKAAGA     71 - 140
RGLSTESILIPRQSETCSPGSD                                                    141 - 162
//

Text Mined References (3)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
15164053 2004 DNA sequence and analysis of human chromosome 9.