Knowledge Summary

Patent

No data available

Synonym

Accession Q5VSD8
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MKLAKTAVLDPATYTSFSPGLSTCSSSQPPGDRRKGLLGCVGSGHCPLPTPAQFPKVQRPPTLLGGKNTS      1 - 70
TQTTLHPVI                                                                  71 - 79
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.