Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 4 medulloblastoma 1875 3.58768781579338E-4
psoriasis 6685 0.00194861241530777
ductal carcinoma in situ 1745 0.0021809553809586
osteosarcoma 7933 0.00369196480772842
pancreatic cancer 2300 0.00822661806133799
pancreatic carcinoma 567 0.00822661806133811
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0170778285809788
esophageal adenocarcinoma 737 0.0180659511873377

Expression

  Differential Expression (8)

Disease log2 FC p
pancreatic cancer 1.100 0.008
esophageal adenocarcinoma 1.300 0.018
psoriasis -1.300 0.002
osteosarcoma -1.227 0.004
intraductal papillary-mucinous neoplasm ... 1.200 0.017
group 4 medulloblastoma 1.300 0.000
pancreatic carcinoma 1.100 0.008
ductal carcinoma in situ 1.100 0.002

Synonym

Accession Q5VIY5 A8MV20 Q5CZB8 Q5VIY4 Q68DI7
Symbols

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG

Gene RIF (1)

PMID Text
16144304 2 splice variants ZNF468.1 and ZNF468.2 contain 11 C2H2-type zinc finger motifs at their C-termini. They are widely expressed in normal human tissues, except in heart and brain, and they are also co-expressional.

AA Sequence

MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMLKTLSSTGQGNTEVIH      1 - 70
TGTLHRQASHHIGEFCFHEIEKDIHGFEFQWKEDETNGHAAPMTEIKELAGSTGQHDQRHAGNKRIKDQL     71 - 140
GSSFHLHLPEPHIFQSEGKIGNQVEKSINNASSVSTSQRICCRPKTHISNKYGNNSLHSSLLTQKWEVHM    141 - 210
REKSFECIQSFKSFNCSSLLKKHQIIHLEEKQCKCDVCGKVFNQKRYLACHRRCHTGEKPYKCNECGKTF    211 - 280
GHNSSLFIHKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAFAYNSYLAKHTILHT    281 - 350
GEKPYTCNECGKVFNRLSTLARHHRLHTGEKPYKCEECDKVFSRKSHLERHRRIHSGEKPYKCEECCKVF    351 - 420
SRKSNLERHRRIHTGEKPYKCKVCDKAFQRDSHLAQHQRVHTGEKPYKCNECGKTFGQTSSLIIHRRLHT    421 - 490
GEKPYKCNECGKTFSQMSSLVYHHRLHSGEKP                                          491 - 522
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16144304 2005 A novel zinc finger gene ZNF468 with two co-expressional splice variants, ZNF468.1 and ZNF468.2.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.