Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
pancreatic cancer 1.100 0.008
esophageal adenocarcinoma 1.300 0.018
psoriasis -1.300 0.002
osteosarcoma -1.227 0.004
intraductal papillary-mucinous neoplasm ... 1.200 0.017
group 4 medulloblastoma 1.300 0.000
pancreatic carcinoma 1.100 0.008
ductal carcinoma in situ 1.100 0.002

Gene RIF (1)

PMID Text
16144304 2 splice variants ZNF468.1 and ZNF468.2 contain 11 C2H2-type zinc finger motifs at their C-termini. They are widely expressed in normal human tissues, except in heart and brain, and they are also co-expressional.

AA Sequence

MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMLKTLSSTGQGNTEVIH      1 - 70
TGTLHRQASHHIGEFCFHEIEKDIHGFEFQWKEDETNGHAAPMTEIKELAGSTGQHDQRHAGNKRIKDQL     71 - 140
GSSFHLHLPEPHIFQSEGKIGNQVEKSINNASSVSTSQRICCRPKTHISNKYGNNSLHSSLLTQKWEVHM    141 - 210
REKSFECIQSFKSFNCSSLLKKHQIIHLEEKQCKCDVCGKVFNQKRYLACHRRCHTGEKPYKCNECGKTF    211 - 280
GHNSSLFIHKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAFAYNSYLAKHTILHT    281 - 350
GEKPYTCNECGKVFNRLSTLARHHRLHTGEKPYKCEECDKVFSRKSHLERHRRIHSGEKPYKCEECCKVF    351 - 420
SRKSNLERHRRIHTGEKPYKCKVCDKAFQRDSHLAQHQRVHTGEKPYKCNECGKTFGQTSSLIIHRRLHT    421 - 490
GEKPYKCNECGKTFSQMSSLVYHHRLHSGEKP                                          491 - 522
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16144304 2005 A novel zinc finger gene ZNF468 with two co-expressional splice variants, ZNF468.1 and ZNF468.2.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.